Details for Sweet orange Locus orange1.1g030692m

Position : scaf_00032 ( 5`- 803150 .. 805522 -3` )
Annotation :
External links : CoGe
PGDD synteny : orange1.1g030692m

Protein [Map View]
MDPFSGSGSWNMMPSIPSHNSSPAASNQDNLFLSPQHQQQFYQQPTQFPQQQFQQQGRTPQQQQQPQQQQQQNQHHQSLA
SNFHLLHLMENLADAIENGTRDQQSDALVNELNNHFEKCQQLLSSISESLDTKAMTVEGQRRKLEESEQLLNQRKELIDK
YMNSVEELIEYEP*

DNA
ATGGATCCGTTTTCCGGGTCGGGTTCATGGAACATGATGCCATCAATTCCAAGCCACAACAGCTCCCCTGCAGCCTCAAA
TCAAGACAATCTATTTCTCTCCCCACAGCATCAACAACAATTCTACCAACAACCGACTCAATTCCCACAGCAACAGTTTC
AACAACAAGGTCGTACACCTCAACAACAACAGCAGCCGCAACAGCAACAACAACAGAACCAACATCACCAGTCACTCGCT
TCCAACTTCCACCTCTTACACTTGATGGAGAATTTAGCGGATGCTATTGAGAATGGAACTCGGGACCAGCAGTCTGATGC
TTTGGTTAATGAACTAAACAACCACTTTGAGAAGTGTCAGCAGCTGTTAAGTTCAATATCAGAATCACTCGATACGAAGG
CTATGACGGTTGAGGGGCAGAGACGAAAGCTGGAAGAAAGTGAGCAACTGCTAAATCAACGGAAGGAACTGATTGACAAA
TATATGAACTCTGTGGAAGAGCTTATCGAGTATGAACCATAA