Details for Sweet orange Locus orange1.1g028261m

Position : scaf_00003 ( 5`- 3264172 .. 3266509 -3` )
Annotation :
External links : CoGe
PGDD synteny : orange1.1g028261m

Protein [Map View]
MIRLTLTLVLVIGILSSTSQSLRFEIQSAHTKCIAEDIKSNSMTVGKYNVVNPNDGHPLPESHKLTVRVTSAYGNSYHYA
DRVDSGQFAFTAAEAGDYMACFWAVDHSPQTTVTIDFDWRTGVQAKDWSNVAKKGSVDVMELELKKLYDTVSSIHQEMFY
LREREEEMQELNRVTNSRMAWFSGFSLFICIAVAGMQLWHLKTFFEKKKLI*

DNA
ATGATCAGATTAACGCTGACTCTTGTTTTAGTCATCGGGATTTTATCCTCGACTTCGCAATCACTCCGTTTCGAGATACA
ATCGGCCCACACTAAATGCATCGCCGAAGACATCAAAAGCAACTCCATGACCGTCGGGAAGTATAACGTCGTCAACCCTA
ACGACGGCCACCCCTTGCCCGAATCACATAAACTCACCGTCAGGGTGACGTCGGCTTACGGTAATAGTTATCATTACGCG
GACCGAGTTGACTCGGGCCAGTTTGCGTTTACGGCTGCCGAGGCTGGCGATTACATGGCTTGTTTTTGGGCCGTTGATCA
TAGCCCGCAAACAACGGTGACGATTGATTTTGATTGGAGGACTGGTGTGCAAGCTAAGGACTGGTCTAACGTTGCAAAGA
AAGGTTCTGTTGACGTCATGGAATTAGAGCTGAAGAAGTTGTATGATACTGTTAGTTCTATTCACCAGGAGATGTTTTAT
CTCCGTGAAAGAGAAGAAGAAATGCAGGAGCTGAACCGTGTTACTAACTCCAGAATGGCCTGGTTTAGTGGGTTTTCGCT
GTTTATATGCATTGCTGTTGCTGGCATGCAACTATGGCACTTGAAAACATTCTTTGAGAAAAAGAAGCTTATATAA