Details for Sweet orange Locus orange1.1g027617m

Position : scaf_00015 ( 5`- 1405331 .. 1407438 -3` )
Annotation :
External links : CoGe
PGDD synteny : orange1.1g027617m

Protein [Map View]
MSDVFERYERQYCEISANLSKKCTAAASLDGERKKQKVSEIQTGLDEAESLIRKMDLEARSLQPNVKAVLLAKLREYKSD
LNNLKSEVKRLVSGNLNAAARDELLESGMADALTASADQRSRLMMSTERVNQSTDRIKDSRRTMLETEELGVSILQDLSS
QRQSLLHAHNTLHGVDDNVSKSKKVLTAMSRRMSRNKWIIGTVVAVLVIAIILILYFKLAK*

DNA
ATGAGTGACGTATTTGAAAGGTACGAGCGACAATACTGTGAGATTTCAGCGAATCTCTCAAAAAAGTGTACGGCAGCTGC
GTCTCTTGATGGAGAAAGGAAGAAGCAAAAAGTATCTGAAATTCAAACTGGATTGGATGAGGCTGAATCTTTGATACGAA
AAATGGACCTTGAGGCAAGAAGTTTGCAGCCAAATGTTAAGGCTGTACTTCTAGCTAAGTTAAGGGAGTATAAATCAGAT
TTAAACAATCTGAAAAGTGAAGTTAAAAGACTTGTTTCTGGAAATTTGAATGCCGCTGCTCGAGATGAGTTATTGGAATC
AGGAATGGCCGACGCTTTGACGGCATCAGCTGATCAAAGGTCAAGGTTAATGATGTCAACGGAAAGGGTAAATCAGTCCA
CTGATAGAATTAAAGATAGTAGAAGAACCATGCTGGAAACAGAAGAGCTTGGTGTTTCAATTCTTCAAGATCTGAGTTCA
CAAAGACAATCTCTTTTGCATGCTCATAATACACTTCATGGAGTGGATGATAACGTTAGCAAGAGTAAGAAAGTTTTAAC
GGCCATGTCAAGAAGGATGAGCAGGAACAAGTGGATTATTGGTACTGTTGTCGCAGTCCTCGTTATTGCAATCATCTTGA
TTTTGTACTTCAAACTTGCTAAATAG