Details for Strawberry Locus mrna09454

Position : LG5 ( 5`- 10423206 .. 10425601 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09454

Protein [Map View]
MALATPATFGFSNLLETFTVNVQRAENRPLNVPLIAPFTIATSRLERVENVAIRVELSNGCVGWGEAPILPHVTAEDQDT
AMVKAKEACEFLLRNNGMTLSSVLGEIGVLLPGYEFASVRAGVEMAVIDAVATSIGVPLWRLFGGASNTITTDITIPIVS
ADEAAKLASKYCKEGFKTLKLKVGKNLNADIEVLQAIRAVHPDCSFILDANEGYTSNEAIQVLEKLYEVGVSPVLFEQPV
HRDDWEGLGYVTRIAKERYGVSVAADESCRSIVDVKKIAEQSLANVINIKLTKVGVVGALEIIEVARASGLDLMIGGMVE
TRLAMGFSGHLAAGLGCFKFIDLDTPLLLSEDPVLEGYEVSGSVYKFNNARGHGGFLHWDNLAW*

DNA
ATGGCTCTGGCCACCCCAGCCACATTTGGGTTCAGTAACTTACTCGAGACTTTCACGGTCAACGTTCAGAGAGCAGAGAA
CAGGCCCCTGAATGTGCCTTTGATCGCTCCTTTCACGATTGCGACTTCGAGGCTTGAACGTGTTGAGAATGTTGCCATCA
GAGTTGAGTTGAGTAATGGGTGTGTGGGGTGGGGTGAGGCTCCAATCTTGCCTCATGTGACTGCAGAGGATCAGGACACT
GCTATGGTTAAGGCCAAGGAGGCTTGTGAGTTCTTGCTCAGGAATAATGGGATGACTTTGAGTTCGGTTTTGGGTGAGAT
TGGTGTGCTTCTTCCTGGATATGAGTTTGCTTCTGTTAGGGCTGGAGTCGAGATGGCTGTAATTGATGCGGTTGCTACAA
GTATTGGTGTCCCTTTGTGGAGACTGTTTGGTGGAGCTTCAAATACCATAACCACAGATATAACGATTCCGATAGTTTCT
GCAGATGAAGCTGCTAAACTGGCTTCAAAGTATTGCAAAGAAGGCTTTAAGACTTTAAAGCTTAAGGTGGGAAAGAATCT
AAATGCAGACATAGAGGTCCTTCAAGCTATACGTGCTGTCCACCCTGATTGCTCTTTCATCTTGGATGCTAACGAAGGAT
ATACCTCCAATGAAGCTATCCAAGTACTTGAGAAATTATATGAGGTAGGAGTGAGTCCAGTTCTCTTTGAACAGCCTGTT
CATAGAGATGATTGGGAAGGCCTTGGATATGTTACTCGTATTGCTAAAGAAAGATATGGAGTATCAGTTGCAGCTGATGA
GAGCTGTCGAAGTATAGTTGATGTTAAGAAAATAGCAGAACAAAGTCTTGCTAATGTCATTAACATAAAACTTACTAAAG
TTGGGGTTGTTGGGGCCCTTGAAATCATTGAGGTTGCAAGAGCATCAGGATTGGATTTGATGATTGGTGGTATGGTTGAG
ACTAGACTCGCCATGGGTTTTTCTGGCCACCTTGCTGCTGGTCTTGGGTGCTTTAAGTTTATTGATCTAGATACGCCCCT
ATTGTTGTCAGAAGATCCAGTTCTGGAGGGCTATGAAGTTTCGGGTTCTGTTTATAAGTTCAACAATGCTAGAGGCCATG
GTGGATTTCTCCACTGGGACAACCTTGCTTGGTAA