Details for Strawberry Locus mrna09451

Position : LG5 ( 5`- 10415066 .. 10415848 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09451

Protein [Map View]
MKQSIIRNLSLYARTRLLSPPCYKSSSQLALSTRPRLSFYSTESQNQEVSKDEDDNISNEELKMQIDDYFKGNDKAFPTI
FEAILKRKLSGKHEQTDKQLMEELRGKKQGSLSDDDEEDDDEIESDFDEYYGSDEKAADLNQAMDRLMKEMPNTKREN*

DNA
ATGAAACAGTCTATCATTAGAAACCTCTCTCTTTATGCCCGTACTCGTCTTCTCTCTCCTCCCTGCTACAAATCCAGTTC
CCAACTCGCTCTTTCCACTCGGCCCAGATTGAGTTTCTACTCGACTGAGTCACAAAATCAAGAGGTCTCCAAAGATGAAG
ACGATAACATCAGCAACGAAGAGCTGAAAATGCAAATTGACGATTACTTTAAAGGAAATGACAAAGCATTTCCAACTATC
TTTGAGGCGATTCTGAAGAGGAAGTTATCAGGGAAGCATGAACAGACTGACAAGCAGTTGATGGAAGAGCTTCGGGGGAA
GAAGCAGGGATCGCTGAGTGACGATGACGAGGAGGATGACGATGAGATTGAATCTGATTTCGATGAGTATTATGGGAGTG
ATGAGAAGGCTGCGGATTTGAATCAGGCAATGGATAGGTTGATGAAGGAGATGCCAAACACAAAGAGAGAAAATTGA