Details for Strawberry Locus mrna09448

Position : LG5 ( 5`- 10396401 .. 10398739 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09448

Protein [Map View]
MDPSPLPPLPAAATATAASVQLSYPDSLESSPRSRNADAAWDVEPLPQVPGAKLRLMCSYGGHIIPRPHDKSLCYVGGET
RIIVVDRHSSLSDLCSRLSRTLLNGRPFSLKYQLPTEDLDSLISVTTDEDLENMVEEYERTTSSASPLKPSSRIRLFLFF
GKPETTASMGALLHEAKSDSWFVDALNGSGMLPRNLSDSAATMDCLLTGGSDSCNDLEAAAANQGDFFGDHGSGKPNVAV
PEVHSISDSAFVENNTSSSGSSTSSSCLANLPQIKVRVDGNVAGVVQGQKPAGIEEQFAQISLVAAAPVAVNSGAGETMN
RINSEDDISAQNVPVAFRKPPLPMPLQPQHFKHGGGGGGGYSLPSPDSVASDSSIASANSLSKPMYYQEQVQVVAREARG
PVSPPSDTSDQGSRNQVQDSGYSIPPQSDQQQQNQLQQQQQQQQQLLQQQHQQQQQLQQQHLQQQQQQQQQFVHASAQYM
NIQHPVTGQVPVSPYYTMYAPPSQQQQLHHQIDHQQQYPVYIMPVPQSQQPYKMALQSNIADPTVVASTHITSHNPAAYK
DSIPPIYPPKTASPAMTEMTQSLYQTSVTPTPQLVQIPSGQYQQQFVGYSMHHPSQSITVPSSTTAPNYAYEYANPSHEQ
VFYTQHQASPLPQYQSMTPAAAAAAVAMSDEAKQVASSYPTADQSHTPP*

DNA
ATGGATCCATCACCTCTCCCACCACTCCCGGCCGCCGCAACCGCCACGGCTGCCTCCGTGCAACTCAGCTACCCGGACTC
ACTCGAATCCTCCCCCCGATCCCGCAATGCGGACGCTGCTTGGGACGTCGAGCCTCTCCCTCAGGTCCCCGGCGCCAAGC
TCCGGCTCATGTGCAGCTACGGCGGCCACATCATCCCTCGGCCGCACGACAAGTCGCTCTGCTACGTCGGCGGCGAGACT
CGCATTATCGTCGTGGACCGCCACTCCTCACTCTCCGACCTCTGCTCCCGCCTCTCCCGGACGCTCCTCAACGGCCGCCC
GTTCTCGCTCAAGTACCAGCTCCCGACGGAGGACCTCGACTCGCTCATCTCCGTCACCACCGACGAGGATCTCGAGAACA
TGGTGGAGGAGTACGAGCGCACCACCTCGTCGGCGTCGCCGTTAAAGCCGTCGTCGAGGATCCGTCTATTCCTCTTCTTC
GGCAAGCCGGAGACGACGGCGTCCATGGGGGCTCTGCTCCACGAAGCCAAGTCCGATTCGTGGTTCGTCGACGCGCTCAA
CGGCTCTGGTATGCTGCCGCGGAATTTGTCCGACTCGGCCGCGACCATGGACTGCTTGTTGACCGGCGGGAGTGACTCTT
GTAACGACTTGGAGGCGGCGGCGGCGAATCAGGGCGACTTCTTCGGGGATCATGGTAGTGGAAAACCTAATGTGGCGGTG
CCTGAAGTGCATTCGATTTCGGATTCGGCGTTTGTGGAGAACAATACGTCGTCGTCTGGATCGTCTACTTCGTCGTCTTG
CTTGGCCAATTTGCCCCAAATTAAGGTTAGAGTGGATGGAAATGTGGCTGGAGTAGTGCAAGGTCAGAAGCCAGCTGGCA
TTGAGGAGCAGTTCGCTCAGATAAGCTTGGTTGCTGCTGCTCCTGTGGCTGTAAACTCTGGAGCTGGTGAAACTATGAAC
AGGATCAACTCGGAGGATGATATTTCGGCACAGAATGTGCCTGTCGCGTTTCGAAAACCGCCTTTGCCAATGCCGTTGCA
GCCTCAGCATTTCAAGCATGGTGGTGGTGGAGGTGGAGGTTATAGCTTGCCTTCACCGGATTCAGTTGCAAGTGATAGTA
GCATTGCGTCTGCAAACTCTCTGTCAAAACCAATGTACTATCAAGAGCAAGTTCAAGTTGTAGCTAGAGAGGCCAGAGGT
CCTGTTAGCCCGCCAAGTGATACTTCAGATCAGGGTTCCCGAAACCAAGTTCAGGATTCAGGGTACAGTATTCCTCCACA
ATCAGATCAACAACAGCAAAATCAGCTTCAGCAACAACAGCAGCAACAACAACAACTGTTACAGCAGCAGCATCAGCAGC
AACAACAGCTCCAACAGCAGCATCTCCAGCAGCAGCAACAGCAGCAACAACAATTTGTCCATGCAAGCGCGCAATATATG
AATATTCAGCACCCTGTTACTGGTCAAGTGCCAGTGTCACCTTACTACACAATGTATGCTCCTCCATCGCAGCAGCAACA
ACTTCATCACCAAATTGATCATCAGCAGCAGTATCCTGTCTATATAATGCCTGTTCCACAGTCGCAACAACCATACAAGA
TGGCTCTGCAGTCTAATATAGCCGATCCAACTGTTGTTGCCTCGACCCACATTACCTCCCATAACCCTGCTGCTTACAAG
GACAGTATCCCACCCATTTATCCCCCAAAGACAGCTTCACCTGCTATGACCGAAATGACTCAAAGTCTTTACCAAACCTC
TGTGACACCAACTCCTCAATTAGTCCAAATCCCTTCCGGGCAATATCAGCAGCAGTTTGTTGGTTACTCAATGCATCATC
CATCTCAATCCATTACTGTTCCTTCCTCTACGACAGCACCCAACTATGCTTATGAATATGCCAATCCTTCACATGAACAA
GTATTCTACACTCAGCATCAAGCATCCCCATTGCCTCAATACCAATCCATGACTCCAGCAGCCGCAGCCGCAGCAGTAGC
AATGTCAGATGAAGCAAAGCAGGTAGCCTCATCATACCCAACAGCGGATCAAAGCCACACACCACCGTAA