Details for Strawberry Locus mrna09447

Position : LG5 ( 5`- 10390248 .. 10392276 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09447

Protein [Map View]
MSDVHMGSHTLKSHGVKVAKSHMYDWMILVVLGAIDITLNLIEPFHRFISEQMMNDVSYPFHPDTIPMWAVPIFAIILPA
GIFFAFYLKRKDVYDLHHSILGLLYSVLITLVITDSIKDAVGRPRPNFFWRCFPDGIGVYDQKYGNVMCTGDKLIIKEGY
KSFPSGHSSVSFAGLGFLSWYLAGKIKVFDRRGHSAKLCIVLFPLLCAALVATSRVDDYWHHWQDVLCGSLIGIVIASIC
YLQSFPYPNKEEERNDALATRLEPLHARRSDVETPDDSIPPEARCIYALGSLASFIFISLAHFSGNMQTFAAFKIQMRRF
RRRRRYRRLGSVVITEEHAAGGRGNLKFWRIRVTPKLRLKVTTSSMAVLRRLRNAYVGMMLCFAGRVAQLNSC*

DNA
ATGTCAGACGTTCATATGGGATCTCACACACTGAAATCTCATGGAGTCAAAGTGGCTAAATCGCACATGTATGACTGGAT
GATTCTTGTAGTTCTTGGGGCCATCGATATTACTTTGAATCTCATCGAGCCTTTTCACCGGTTTATTAGTGAACAAATGA
TGAATGATGTATCCTACCCTTTTCATCCAGACACTATACCTATGTGGGCTGTTCCGATTTTTGCAATAATCTTGCCGGCC
GGTATCTTTTTTGCTTTCTACCTCAAGAGAAAGGATGTTTATGACTTGCACCATTCTATATTGGGTCTTCTCTATTCAGT
TCTGATAACTCTGGTTATCACTGATTCAATCAAAGATGCTGTTGGTCGCCCCCGTCCCAACTTCTTCTGGCGGTGTTTTC
CTGATGGAATAGGTGTATATGATCAGAAGTATGGCAATGTTATGTGTACTGGAGATAAGTTGATTATAAAGGAAGGATAT
AAAAGCTTTCCTAGTGGTCATTCTTCAGTTTCATTTGCAGGCCTCGGTTTTCTTTCGTGGTACTTGGCTGGGAAGATCAA
AGTGTTTGATCGTCGAGGCCATAGTGCAAAGCTGTGCATTGTGCTGTTTCCACTACTTTGTGCTGCTTTGGTTGCAACCT
CACGGGTGGATGACTACTGGCATCATTGGCAAGACGTCTTGTGTGGTAGTCTTATAGGAATTGTCATAGCATCAATTTGT
TACTTGCAGTCCTTCCCTTATCCAAACAAGGAAGAGGAGCGGAATGATGCCTTGGCGACAAGGCTTGAACCTCTTCATGC
ACGAAGATCAGATGTCGAAACTCCAGATGATTCCATTCCACCTGAAGCTAGATGCATCTATGCACTTGGAAGCTTAGCCA
GCTTCATCTTCATTTCACTTGCACATTTCTCTGGAAATATGCAGACATTTGCAGCATTCAAGATTCAGATGAGGAGGTTC
CGGAGGAGGAGACGTTATCGTAGGCTAGGAAGTGTGGTTATTACTGAGGAACATGCAGCCGGAGGGAGAGGGAATCTAAA
GTTTTGGAGAATTAGAGTGACCCCAAAACTGCGGCTCAAGGTTACAACATCATCGATGGCAGTTCTCAGAAGGCTTAGGA
ACGCTTATGTAGGAATGATGCTTTGTTTCGCTGGCCGTGTTGCGCAGTTGAATTCATGTTAG