Details for Strawberry Locus mrna09438

Position : LG5 ( 5`- 10340248 .. 10344512 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09438

Protein [Map View]
MEEEDLDYVLVPLGLCVLGTYHVWLLITVLRHPIRTVIGLNAQSRHQWALSMMSDPLKNGVLAVQTIRNNIMASTLLATT
AITLSSLISVFVSSTSNSGNTSNLVYGNKTATLSSIKYFSILLCFLVAFLCNVQSIRYYAHVSFLATVPTWQGRKDCIEY
VARNLNRGSYFWSLGLRAFYFSFPLFLWIFGPIPMFACSCVISFVLYFLDTTTSFTRLLHSHSVKENFYSHSEIEEERKC
VVQLELGRKSEMVSLDYILVPAGLFVLGIYHIWLLITVLHNPIRTVIGLNAYTREQWVFSLMTPILSERVVLDDNFRASN
EDWHQVWDPLKNGVLIVQTLRNNIMASTLLSTAAITLCSVIVVFVSSESSSNSTSTRYCAHVSFLGTVPTWKNKTGFIEY
VAATLNRGYYFWALGLRAFYLSVPLFLWIFGPIPMFLSCCVMSVMLYFLDTTSSFAQIIHTQLFKEDEARTNDVESISQP
LNNSEHENFQLRDPLLTSGSMRILDRSVAP*

DNA
ATGGAAGAGGAGGATTTGGACTATGTTCTGGTTCCATTGGGTCTGTGTGTTCTGGGAACATATCATGTTTGGCTTCTGAT
CACTGTGCTACGTCATCCAATACGAACTGTGATCGGTCTGAATGCTCAGTCTCGTCACCAGTGGGCCTTATCCATGATGA
GTGACCCTTTGAAGAATGGTGTTTTGGCTGTCCAGACAATACGCAACAACATAATGGCATCAACACTTTTGGCAACAACA
GCTATCACACTCAGTTCTCTTATCAGTGTGTTCGTCAGCAGTACATCAAACTCCGGAAACACCTCAAATCTAGTTTATGG
CAATAAGACAGCCACTCTCTCTTCAATAAAGTACTTCTCTATCTTGCTGTGCTTTCTTGTTGCCTTTCTCTGCAATGTGC
AGTCTATTAGATACTATGCCCATGTTAGCTTCTTGGCCACTGTTCCAACATGGCAAGGTAGAAAGGATTGTATCGAGTAT
GTTGCAAGAAACTTGAATCGGGGAAGCTACTTTTGGTCACTTGGATTGCGAGCTTTCTACTTCTCATTCCCTCTCTTCCT
TTGGATATTTGGGCCTATACCAATGTTTGCATGCAGCTGTGTCATCTCTTTTGTTCTTTATTTCCTAGACACTACCACCA
GCTTCACACGACTTCTTCACAGTCACTCAGTGAAAGAGAACTTCTACTCACATTCTGAGATAGAGGAAGAAAGGAAGTGT
GTGGTGCAGCTAGAGTTGGGAAGAAAATCAGAGATGGTTAGCTTGGACTATATTCTGGTACCAGCGGGTCTCTTTGTGCT
GGGAATATATCATATTTGGCTCTTAATCACAGTTCTGCATAATCCCATAAGAACTGTTATTGGCCTCAATGCTTACACTC
GTGAACAGTGGGTTTTCTCCTTGATGACTCCAATATTATCAGAAAGGGTAGTACTTGATGATAACTTTCGAGCTAGTAAT
GAAGACTGGCATCAAGTTTGGGACCCCTTGAAGAATGGTGTTTTGATTGTACAAACTTTACGCAACAACATAATGGCATC
GACACTTTTGTCAACAGCAGCAATTACTCTTTGTTCTGTGATCGTTGTATTTGTGAGCAGCGAATCCAGCTCCAATAGCA
CTTCTACTAGATATTGTGCCCATGTCAGCTTCTTGGGCACTGTCCCAACATGGAAAAACAAGACAGGTTTCATTGAGTAT
GTTGCGGCAACTTTGAACCGAGGATATTACTTTTGGGCACTAGGACTGAGAGCATTCTACCTCTCTGTTCCTCTCTTTCT
CTGGATCTTCGGGCCAATACCTATGTTTCTTAGTTGTTGTGTTATGTCAGTTATGCTCTATTTCTTGGACACAACCTCCA
GCTTTGCACAAATTATTCATACGCAATTGTTCAAGGAGGATGAAGCAAGAACCAATGATGTGGAATCGATTTCTCAACCA
TTGAACAATTCTGAACATGAGAACTTCCAACTCCGTGATCCTCTACTGACCAGCGGCAGCATGAGGATTTTGGACAGAAG
TGTTGCACCATGA