Details for Strawberry Locus mrna09436

Position : LG5 ( 5`- 10329358 .. 10333098 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09436

Protein [Map View]
MSAIGNGLGNSNDSAAAFVTMASQRLRLNPNKEHKPESYDDMQLDFSPSIFSSLERYLPPNMLGMPRHDKVKFMREILLK
YLPHGERNRVQKHRDYRQKIILNYQPLHKELYQLDPTITFVPTFLEAVNENTEESFRRICSEPSPGIYTFEIFQPRFCEL
LLAEVENFEKWVGDSKYRIMRPNTMNKYGAVLDDFGLETMLDKLMEGFVRPIAKELFPEVGGATLDSHHGFVVEYGNNRD
LDLGFHVDDSEVTLNVCLGKQFTGGELYFRGIRCDKHVNSGSRPEEVFDYSHTPGYAVLHRGRHRHGAKATTSGHRVNLL
LWCRSSVFREMRKYQKDFSTWCGECLHEKKERQRMSITATKQELLLRKDDES*

DNA
ATGTCGGCGATCGGAAACGGATTGGGGAATTCGAATGATTCGGCGGCGGCGTTTGTGACGATGGCGAGCCAGCGGCTGCG
GCTGAACCCTAACAAGGAGCACAAGCCGGAAAGCTACGACGACATGCAATTGGATTTCAGCCCGTCGATTTTCAGCTCGC
TGGAGCGGTACTTGCCGCCGAACATGCTCGGAATGCCGAGACATGATAAGGTCAAGTTCATGAGGGAGATTCTCCTCAAG
TACTTGCCCCATGGAGAACGCAACAGAGTTCAGAAGCACAGAGATTACAGGCAGAAGATTATATTGAATTACCAGCCTTT
GCATAAAGAGTTATACCAGCTCGATCCCACCATCACCTTTGTCCCGACATTTCTAGAAGCAGTGAATGAGAATACTGAGG
AAAGCTTCAGAAGGATATGTTCTGAACCCTCACCTGGAATATATACTTTTGAGATTTTTCAGCCACGTTTCTGTGAATTG
TTATTAGCCGAGGTGGAGAATTTTGAAAAATGGGTTGGTGACTCCAAATATAGAATCATGCGACCCAATACAATGAATAA
GTATGGTGCTGTTCTTGATGATTTTGGCCTTGAAACCATGCTGGACAAGCTTATGGAGGGTTTTGTTCGTCCTATAGCTA
AAGAGCTGTTTCCTGAGGTTGGTGGAGCAACTTTGGATTCTCATCATGGGTTTGTGGTTGAATATGGTAACAATAGGGAT
CTTGACTTGGGTTTTCATGTTGATGACTCAGAAGTAACTTTGAATGTGTGCTTGGGAAAACAATTTACTGGAGGAGAGTT
GTATTTCCGGGGAATACGTTGTGATAAACATGTAAATAGCGGAAGCCGTCCAGAGGAAGTCTTTGATTATTCTCATACCC
CAGGATATGCTGTGCTTCATCGTGGTCGTCACAGGCATGGTGCTAAAGCCACGACATCAGGTCATCGTGTCAATTTACTT
CTATGGTGCAGGAGTTCTGTTTTCAGAGAGATGAGGAAGTATCAGAAAGATTTCTCTACCTGGTGTGGGGAATGCTTGCA
TGAGAAGAAAGAGAGGCAACGAATGTCAATTACAGCTACCAAACAGGAGTTGTTGCTCAGGAAGGATGATGAGTCCTAA