Details for Strawberry Locus mrna09431

Position : LG5 ( 5`- 10311116 .. 10312939 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09431

Protein [Map View]
MMYDSILARSFSRHEQKKLGYGAFLCCLFLALCFCTVLKPSLNPLPALNLQRSLGVRNKILALMESNNESNSSEHVVITT
KVIDRIIKNEEFKNVSLIHEDEVEDSKQEQKDESIAESVTTSPISSSGDDDDHETKIVEVVTKTASVERIICNVKQPRTE
YCEVNGDARVDGKSSSVIVASSQLEMSSEGNGSWTIRTYARKEDATAMSHARKWFVKQASTDDPETPQCSRNHNVPAILF
SSGGYTGNHFHDFTDVVIPLFITSRKYKGEVQFLVTDIRPFWIEKFKAILKGLSNYQFIDIDNEQEVHCFPSITVGLIRH
EKELSINDPSKYSHTMKDFREFLRETYSLKKSNAIRVKDGQRKKPRLLIIPRKRTRSFTNTGEIMRMAKRLGYKVSVAEG
ISDVAKFAQLVNACDVLMGVHGAGLTNILFLPENAVVIQILPVGGFEWLAMTDFGEPSQDMNLKYLEYKISNEESTLIQQ
YPLDHAVFTDPYSIGKQGWEAFKSIFLDKQNVKLNVDRFKPTLLKALELLHQ*

DNA
ATGATGTATGATTCAATACTTGCCAGAAGCTTCAGTCGGCATGAGCAGAAGAAACTAGGATATGGAGCCTTTCTTTGCTG
CTTGTTCCTAGCATTGTGCTTCTGCACAGTGCTGAAGCCTAGTTTGAATCCTCTACCAGCTTTGAATTTGCAGCGATCAC
TTGGTGTCAGAAACAAGATACTGGCACTAATGGAGTCGAACAACGAATCGAACAGCTCTGAGCATGTAGTGATCACAACT
AAAGTTATTGATCGCATCATAAAGAACGAAGAGTTCAAGAATGTGAGTCTTATTCATGAAGATGAAGTAGAAGATTCTAA
ACAAGAGCAGAAAGATGAAAGCATTGCGGAGAGTGTTACTACTAGTCCCATTTCGAGCAGCGGTGACGATGATGATCATG
AGACAAAGATTGTTGAAGTTGTGACAAAGACGGCTAGTGTGGAGCGAATTATTTGCAATGTCAAGCAACCAAGAACTGAA
TATTGCGAGGTCAACGGTGATGCTCGGGTGGATGGAAAATCTTCCTCAGTTATTGTTGCTTCATCTCAACTGGAGATGTC
ATCAGAGGGCAATGGCTCCTGGACTATAAGAACTTATGCTCGAAAAGAAGATGCAACAGCAATGAGTCATGCTAGGAAAT
GGTTTGTGAAACAAGCAAGTACAGATGATCCGGAAACTCCTCAATGTAGTAGGAATCATAATGTTCCGGCCATTCTGTTT
TCAAGTGGAGGATACACTGGAAACCATTTCCATGACTTCACTGATGTGGTGATTCCCCTCTTCATCACTTCACGAAAATA
CAAGGGTGAAGTTCAGTTTCTTGTCACAGATATACGACCATTTTGGATTGAGAAGTTCAAAGCAATACTAAAAGGATTGT
CCAACTATCAGTTCATTGACATTGACAATGAGCAAGAAGTCCATTGCTTCCCAAGCATAACCGTTGGCCTCATACGACAC
GAAAAGGAGCTGAGCATCAATGATCCTTCAAAATATTCACATACCATGAAAGACTTCAGGGAGTTTTTGAGGGAAACTTA
TTCCTTGAAGAAATCTAATGCTATTAGAGTCAAAGATGGTCAACGCAAAAAGCCGCGGCTTCTGATCATCCCAAGGAAGA
GAACAAGGTCTTTCACCAATACAGGAGAGATTATGAGAATGGCGAAACGCTTGGGGTACAAGGTAAGTGTGGCAGAAGGT
ATCTCAGACGTTGCGAAATTTGCACAACTTGTGAATGCTTGTGATGTGTTGATGGGAGTTCATGGAGCTGGCCTCACGAA
CATTCTTTTTCTCCCGGAAAATGCAGTCGTCATCCAAATACTTCCGGTTGGAGGATTTGAATGGCTTGCCATGACAGATT
TCGGCGAGCCTTCGCAGGATATGAACCTCAAGTACTTGGAGTATAAGATAAGCAATGAGGAGAGCACATTGATACAGCAA
TACCCTCTTGACCATGCAGTTTTTACTGATCCCTACTCTATTGGAAAACAAGGGTGGGAAGCATTCAAGTCAATCTTTTT
GGACAAGCAAAATGTAAAGCTCAATGTCGATAGGTTCAAACCCACTTTGTTAAAAGCCCTTGAGCTTCTTCACCAGTAG