Details for Strawberry Locus mrna09416

Position : LG5 ( 5`- 10245127 .. 10247595 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09416

Protein [Map View]
MAASALNDELIVLCHQTWLPIVSKESTGIVEKTLQGGAAIVFIYLQGGAATVLICLLQGVATVWTDDFTATVWTDDFAAT
VGKLTAMANATATGAASNEILMLEAPPQGPSWPGPLTNAEIIDALPYIDEDYYSSAAVKNEVDLMVEEELRRSSKKPADF
LKDLPPLAKPDFKNNPVLAREYDRVRASKPPVILDFSRDKAEMPKRSDEAAWRQALQKAQCYSQHNVIRLENLELMDKYG
PDAWIKYNNVLQSLLSRLQKLTHERSQMIGTVNRERKEHQQNTAYELNALHAQWKELSLKNIEIQAACATLENCIDELKK
EAAERGWDFRPTENGLLNSE*

DNA
ATGGCAGCGAGCGCCTTGAACGACGAACTCATCGTCTTGTGTCACCAGACATGGCTGCCGATTGTGTCTAAGGAGTCGAC
CGGCATCGTGGAGAAGACCCTACAAGGTGGTGCTGCTATTGTCTTTATTTACCTACAAGGCGGTGCTGCTACTGTCCTTA
TTTGCCTGCTACAAGGCGTTGCTACTGTTTGGACAGATGATTTCACTGCTACTGTTTGGACAGATGATTTCGCTGCTACT
GTTGGAAAGCTCACAGCAATGGCTAACGCCACCGCCACCGGCGCCGCCAGCAACGAAATCTTAATGTTAGAAGCTCCGCC
GCAAGGCCCGTCGTGGCCTGGCCCCTTAACCAACGCCGAGATCATCGACGCCTTGCCGTACATCGACGAAGACTACTACT
CCAGCGCCGCCGTCAAGAACGAAGTCGACCTCATGGTGGAGGAGGAGCTCCGTCGCAGCTCCAAAAAGCCTGCCGATTTC
CTCAAAGACTTGCCTCCGCTCGCCAAGCCCGATTTCAAGAATAATCCAGTTCTGGCGAGAGAGTACGACCGCGTGAGAGC
TTCAAAGCCTCCGGTGATTCTTGATTTCTCGAGAGATAAGGCGGAGATGCCGAAGAGGAGTGATGAAGCTGCTTGGAGGC
AGGCTCTTCAGAAAGCTCAGTGCTATTCGCAGCACAATGTCATCAGGTTGGAGAATTTGGAGCTGATGGATAAGTATGGC
CCTGACGCCTGGATTAAGTACAACAATGTTTTGCAATCGCTTTTGTCAAGATTGCAGAAATTAACTCATGAGCGCTCTCA
AATGATTGGAACTGTGAATCGTGAAAGGAAAGAACATCAGCAAAACACTGCATATGAGCTTAATGCTTTGCACGCACAAT
GGAAGGAACTTTCTCTGAAGAACATAGAAATTCAAGCCGCGTGTGCTACTCTTGAGAATTGCATAGATGAACTCAAAAAG
GAAGCAGCAGAGAGAGGCTGGGACTTCAGACCAACGGAGAATGGCTTGTTGAATTCTGAATGA