Details for Strawberry Locus mrna09414

Position : LG5 ( 5`- 10234183 .. 10237253 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09414

Protein [Map View]
MLSFRGFWRRHKRKVLVTTGVLGGGYLLYKLYNAHTQRLADLEAELAREQESSDDLLKAKMQAHFESIQSIADTTTLPHV
MHYLSSRIAEELDTTDITERLMQMKGKSPEKLELWDRLKVISFTRMVLSLWAMTMLSLYIRVQVNILGRHLYIDTARGFG
SSLIVEDAELIDRDDQQKFLASSDYLSTYGMPSLILHIQAAAIEVLNGKQLTDRFNTAVLRDTIMQILDKFMGTGSPHHW
VNYLMPEDARWAELATAFSSDSTVLPDVTKFEQLTLETRSVISSGEFGNIAEMALRAVVDTVVVDMGAQSGGDLSSGTPL
AKVLARVAQMGPTLLGESSKFRQIILNVPEVELFFTLIYSQMQIS*

DNA
ATGCTTTCTTTCAGGGGGTTTTGGAGGAGGCATAAGAGGAAGGTGCTTGTTACAACTGGTGTATTAGGAGGTGGATATCT
ACTGTATAAACTATATAATGCTCACACTCAGAGGCTTGCTGACCTGGAGGCCGAACTCGCCCGCGAGCAAGAGAGCAGTG
ATGACCTCCTTAAGGCTAAAATGCAAGCTCATTTCGAGAGCATTCAGAGCATTGCTGATACAACTACGCTACCTCACGTG
ATGCACTATTTGAGTAGTCGGATAGCAGAAGAGTTAGATACTACGGACATCACAGAAAGGTTGATGCAAATGAAGGGGAA
GTCTCCAGAAAAACTTGAATTGTGGGATAGATTAAAAGTTATAAGCTTCACGAGAATGGTGTTATCGTTGTGGGCAATGA
CGATGCTTAGCTTGTATATTAGAGTGCAAGTCAATATATTAGGGAGACATTTATACATTGATACTGCACGTGGTTTTGGA
AGCTCTCTTATAGTTGAGGATGCTGAACTCATTGATAGGGACGACCAACAGAAGTTTCTAGCAAGTTCTGATTATCTGTC
CACTTATGGCATGCCTTCTTTAATTCTACATATCCAGGCAGCAGCAATAGAAGTTCTTAATGGAAAGCAGCTAACCGATC
GATTCAATACCGCAGTTCTCCGTGATACTATTATGCAAATACTTGACAAGTTCATGGGCACAGGAAGTCCCCATCACTGG
GTGAACTACTTGATGCCTGAGGATGCTCGTTGGGCCGAACTAGCGACGGCCTTCAGCAGTGATAGCACAGTTCTTCCGGA
TGTCACCAAATTTGAACAACTTACGTTGGAGACACGGTCAGTGATATCAAGTGGTGAATTTGGGAATATTGCTGAGATGG
CATTGAGAGCAGTGGTGGATACTGTGGTAGTAGATATGGGTGCTCAATCTGGAGGTGATCTATCGTCAGGAACACCTCTC
GCGAAAGTTTTGGCAAGAGTTGCACAGATGGGGCCAACACTCCTTGGAGAATCAAGCAAATTCAGACAGATCATTCTAAA
TGTACCAGAAGTTGAGCTCTTTTTTACTCTCATATATTCACAGATGCAGATCTCATAG