Details for Strawberry Locus mrna09413

Position : LG5 ( 5`- 10231190 .. 10233917 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09413

Protein [Map View]
MGPLRGKTYKSWVLYSIAHTLVIIFPLTPFARSLFSPKTLELSLSRRRRRRAMGSEGLVLKGTMRAHTDMVTAIAIPIDN
SEMIVSASRDKSIILWQLNKDENSYGVPRRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLAQGVSARRFVGHTKD
VLSVAFSIDNRQIVSASRDRTIKLWNTLGECKYTIQEQDGHNDWVSCVRFSPNTLQPTIVSASWDRTVKVWNLTNCKLRN
TLEGHNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAIIHALCFSPNRYWLCAATEQSIKIWDLESKSI
VEDLKVDLKTEAEKTKETGTANKKKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRF*

DNA
ATGGGACCTTTGAGGGGGAAGACCTATAAATCATGGGTCTTGTATAGTATCGCTCACACACTCGTTATCATTTTTCCTCT
CACGCCTTTTGCTCGCTCTCTCTTTTCCCCCAAAACCCTAGAGCTCTCTCTCTCTCGCCGCCGCCGCCGCCGAGCCATGG
GTTCCGAAGGGCTAGTCCTCAAGGGCACCATGAGGGCCCACACCGACATGGTGACCGCCATCGCCATCCCCATCGACAAC
TCCGAGATGATCGTCTCCGCCTCCCGCGACAAATCCATCATCCTCTGGCAGCTCAACAAGGACGAGAACTCTTACGGCGT
CCCCCGCCGCCGCCTCACCGGCCACTCCCACTTCGTCCAGGACGTCGTCCTCTCCTCCGACGGCCAGTTCGCCCTCTCCG
GCTCCTGGGACGGCGAGCTCCGCCTCTGGGACCTCGCCCAGGGCGTCTCCGCCCGCCGCTTCGTCGGCCACACCAAGGAC
GTCCTCTCCGTCGCCTTCTCCATCGACAACCGTCAGATCGTCTCGGCCTCCCGCGACCGCACGATCAAGCTCTGGAACAC
TCTCGGCGAGTGCAAGTACACCATCCAGGAGCAGGACGGCCACAACGACTGGGTCAGCTGCGTCAGGTTCAGCCCCAACA
CCCTCCAGCCCACCATCGTCTCGGCCTCGTGGGACCGCACCGTCAAAGTCTGGAACTTGACCAACTGCAAGCTGAGGAAC
ACCCTCGAGGGCCACAATGGCTATGTCAACACCGTGGCGGTGTCTCCTGATGGCTCCTTGTGCGCCAGCGGAGGCAAAGA
TGGAGTCATTTTGCTGTGGGATTTGGCCGAGGGAAAGAGGCTGTACTCGCTTGATGCTGGTGCCATTATTCATGCTCTGT
GCTTCAGCCCCAACAGGTACTGGCTGTGCGCTGCGACTGAGCAGAGCATTAAGATCTGGGATTTGGAGAGCAAGAGCATT
GTTGAGGATTTGAAGGTCGATTTGAAGACAGAGGCCGAGAAGACAAAGGAGACCGGCACTGCCAACAAGAAGAAGGTTAT
CTACTGTACTAGCTTGAACTGGAGTGCAGATGGAAGCACATTGTTCAGTGGATATACCGATGGCGTCATCAGAGTTTGGG
GAATCGGCCGCTTCTAG