Details for Strawberry Locus mrna09412

Position : LG5 ( 5`- 10217336 .. 10223463 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09412

Protein [Map View]
MSPLAENDEIPYYDDDDDDEYDDGFNDDIEALRRACMITGQDPDDVIAKNDQGKNPSIHQNDDDDIDVGPSSAPNSDSDS
DFDEDLELLRKIKNQFSDNKPLSLKPLCTLLPPSVSDEEEDDYQTLLAVRKRFAAYENDTQGKSAVQIDPPCKSVQETCN
EVSGSEAHERFPYLVTYTEEGKPSTSIEWNQSDSCKPSMSPTKSSGFPKSALAFWDAIIKNRSCQKFLGSKLIQIKAKIE
ENNKLKQRVKILRDFQAHCKRRTGEALSQKKDPCVQLILTKRPRVDSKAHDRAISALSYGPEENSHVADYRKALTKFPVS
LDRKNWSEAEKKDLQKGIRQQFQEMVLQSSMDESSYSETRHGDSDAIDNILASIKDLEITPYSIKEFLPKVNWEQLASMY
VPGRSGGECEARWLNWEDPLVNHGPWTTDEDKMILYLVQKNGVNDWINIAEAVGTNRTPFQCLARYQRSLNASILKREWT
KDEDAQLSSAVEAFGERDWQSVASALNGRTGTQCSNRWKKSLHPTRTRAGKWTPEEDKRLIVAQMLFGSKNWNKTAQFVP
GRTQAQCRDRYVNSLEPSLKWCEWTEEEDSRLIKAIEECGHCWSKVAAYVPNRTDNMCWRRWKVLFPDEVPLLREEKKIR
KTALIRNFVDREKERPALGPNDFLLQDGTSRKSLTRKTGGLSRVPKKIKPRRHRNNAQLCSEEETGTSNSEVETYDDDDA
SKKRKKKNVLKPHQIRHKDNEPTGDCEAVALVPKKIRPRRNRNSGQIPGVSHSEVRTCNGDDAMKKKIRRHRRQKGTEPT
GECKAIVPVSNEDDAPKEPTEKSCSDQIIGTSDEEKAISHFLHESKKRKLEVADDETDNPVVASLGKKKYKKRHAQTTKR
HAQIQEATIKSGKEQASSGDDMTLNCFLRNRSKKRRESGRGDIQNFR*

DNA
ATGTCTCCGCTCGCCGAGAACGACGAGATTCCTTACTACGATGACGACGACGACGACGAATACGACGACGGCTTCAACGA
CGACATTGAGGCCCTCCGCCGCGCCTGTATGATCACCGGCCAAGACCCCGACGACGTCATCGCCAAAAACGACCAAGGAA
AAAACCCTAGCATCCACCAAAACGACGACGACGACATAGACGTAGGCCCCTCCTCCGCTCCCAATTCCGACTCCGACTCC
GATTTCGACGAGGACCTCGAGCTGCTCCGCAAAATCAAGAACCAATTCTCCGATAACAAGCCTCTTTCGCTGAAGCCTCT
CTGTACTTTGCTGCCGCCTTCCGTCTCCGACGAGGAGGAGGACGACTACCAAACGCTACTCGCCGTGAGGAAACGTTTCG
CTGCTTACGAGAACGATACTCAGGGTAAAAGTGCAGTGCAGATTGATCCTCCCTGCAAATCAGTCCAGGAAACTTGCAAT
GAAGTATCTGGAAGTGAGGCTCATGAAAGGTTTCCGTATCTGGTCACCTATACTGAAGAGGGGAAGCCTTCCACTTCCAT
TGAGTGGAATCAGTCAGATTCTTGTAAGCCATCTATGTCGCCAACCAAAAGTTCAGGATTCCCAAAGTCTGCACTGGCTT
TTTGGGATGCTATTATTAAGAATAGGTCCTGTCAGAAGTTTCTTGGAAGTAAGCTAATACAAATCAAAGCTAAAATTGAG
GAGAACAACAAACTGAAGCAGCGTGTCAAAATCCTTAGAGACTTTCAAGCTCATTGCAAAAGACGAACAGGAGAAGCGCT
GTCTCAAAAGAAGGATCCCTGTGTCCAGTTAATTTTAACGAAAAGGCCAAGGGTTGATTCAAAGGCACATGACAGAGCTA
TCTCAGCTTTGTCCTATGGCCCAGAAGAAAATTCACATGTTGCTGACTACAGAAAGGCATTGACAAAATTTCCAGTTTCA
TTAGATCGAAAAAATTGGTCAGAGGCAGAAAAGAAAGATCTTCAAAAGGGAATAAGACAGCAATTTCAAGAAATGGTTCT
TCAATCTTCCATGGATGAATCAAGTTATTCTGAGACGCGTCATGGAGACTCAGATGCCATTGATAACATTTTGGCTTCAA
TCAAGGATCTCGAAATTACCCCATACAGCATTAAGGAGTTCCTGCCTAAGGTTAACTGGGAGCAGTTGGCTTCCATGTAT
GTTCCTGGTCGCTCTGGTGGAGAATGTGAAGCAAGGTGGTTGAACTGGGAGGATCCCTTAGTCAATCACGGACCATGGAC
TACGGATGAGGATAAGATGATTCTGTATCTTGTCCAGAAGAATGGGGTCAATGATTGGATTAATATTGCAGAAGCGGTTG
GGACTAACAGGACTCCATTTCAGTGCTTGGCACGCTACCAAAGGAGCCTAAATGCTTCTATTCTGAAACGGGAGTGGACC
AAGGATGAGGATGCACAACTTTCTTCTGCTGTAGAGGCTTTTGGTGAGAGGGATTGGCAGTCTGTAGCTTCTGCTTTGAA
TGGACGAACTGGTACTCAATGCTCTAACAGATGGAAGAAATCACTTCATCCAACCAGAACAAGAGCTGGTAAATGGACTC
CAGAGGAAGACAAACGCCTGATTGTAGCTCAAATGCTTTTTGGGTCAAAAAATTGGAACAAGACAGCTCAATTTGTGCCG
GGTCGAACTCAGGCACAATGCAGGGATAGATATGTCAACTCTTTAGAACCTTCTTTGAAGTGGTGTGAATGGACTGAAGA
AGAGGATTCAAGATTGATTAAGGCAATTGAAGAATGTGGACATTGCTGGTCAAAAGTTGCTGCATATGTGCCTAACCGGA
CTGATAATATGTGCTGGAGGAGATGGAAGGTATTGTTTCCGGATGAAGTGCCTTTGCTCAGAGAAGAGAAAAAAATACGT
AAGACCGCTCTCATCCGCAACTTTGTTGATCGGGAGAAAGAACGCCCAGCCCTTGGCCCTAATGATTTTCTTCTACAAGA
CGGTACCTCAAGGAAGAGTTTAACTAGGAAGACAGGAGGATTAAGCCGAGTTCCAAAGAAGATTAAACCAAGGAGGCATA
GAAACAATGCTCAACTTTGCTCCGAGGAAGAAACTGGGACAAGCAATTCGGAGGTTGAGACATATGATGACGATGATGCC
TCAAAGAAGAGGAAAAAGAAGAATGTTCTCAAACCGCATCAAATAAGGCACAAAGACAATGAACCCACAGGAGACTGTGA
GGCTGTTGCACTTGTACCAAAGAAGATTAGACCTAGGAGGAATAGAAACAGCGGTCAAATTCCTGGAGTAAGCCATTCTG
AGGTTCGGACATGTAATGGGGATGATGCCATGAAGAAGAAAATTCGGCGTCACAGAAGGCAGAAAGGCACTGAACCGACA
GGAGAGTGTAAGGCTATTGTACCTGTTAGTAATGAGGATGATGCGCCCAAAGAACCCACAGAGAAATCTTGTTCCGATCA
AATCATAGGAACATCAGATGAAGAGAAAGCTATTTCTCACTTTCTACATGAATCAAAGAAGAGAAAGCTTGAAGTTGCTG
ATGATGAGACTGATAATCCTGTTGTGGCTTCCTTGGGGAAAAAGAAATACAAGAAGAGGCATGCTCAAACTACTAAACGG
CATGCTCAAATACAAGAGGCCACAATCAAATCTGGGAAGGAACAAGCGAGCAGTGGCGATGATATGACACTTAATTGTTT
TTTACGTAATAGATCAAAGAAGCGACGTGAATCTGGCAGAGGAGATATTCAGAATTTCAGATGA