Details for Strawberry Locus mrna09408

Position : LG5 ( 5`- 10195541 .. 10198760 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09408

Protein [Map View]
MPQLAEAYACVPSTERGRGILISGDPKSNRLLYTNGRSVIIMNLDNPLDVAVYAEHAYPATVARFSPNGEWIASADVSGT
VRIWGTHNDFVLKNEFKVLSGRIDDLQWSADGLRIVACGEGKGKSLVRAFMWDSGSTVGDFDGHSKRVLSCVFKPTRPFR
IVTCGEDFLVNFYEGPPFKFKQSHRDHSNFVNCVRYSPDGSKFITVSSDKKGLIFDGKTAEKIGELSSEDGHKGSIYALS
WSPDGKQILTVSADKTAKIWDICEDYHGKVHKTLTCPGSGGVEDMLVGGLWQNDHIVTVSLGGMISIFSASDLDKAPLSL
FGHMKNVTSLSVLKNDPKVILSTSYDGLIVKWIQGVGYSGKLQRKETSQIKCFAAVEEEIVTSGFDNTVWRVPLNGDQCG
DAESIDVGSQPKDISHALHYPELVLVSTDSGALLLRGGKVVSTINLGFTVTASAIAPDGSEAIIGGQDGKLHIYSIAGNT
LTEEAVLEKHRGAISVIHYSPDVSMIASGDLNREAVIWDRASREVKLKNMLYHTARINCLAWSPDNSMVATGSLDTCVII
YEVDKPASSRVTIKGAHLGGVYGIAFTDEHTVVSSGEDAFVRVWKLTPQ*

DNA
ATGCCCCAACTCGCCGAGGCCTACGCCTGCGTCCCCTCGACGGAGCGCGGCCGCGGGATCCTGATCTCCGGCGACCCCAA
ATCCAACCGGCTCCTCTACACCAATGGCAGATCCGTCATCATCATGAACCTCGACAACCCTCTCGACGTCGCCGTCTACG
CCGAGCACGCCTACCCGGCCACCGTCGCCAGATTCTCCCCCAACGGCGAGTGGATCGCCTCCGCCGACGTCTCCGGCACC
GTCCGGATCTGGGGGACCCACAACGATTTCGTCCTCAAGAACGAGTTCAAGGTCCTCTCCGGCCGGATCGACGACCTCCA
GTGGTCCGCCGACGGCCTCAGGATCGTCGCCTGCGGTGAGGGCAAAGGGAAATCCCTCGTTCGCGCCTTCATGTGGGATT
CAGGGTCTACTGTTGGGGATTTTGATGGGCATTCGAAGCGGGTTTTGAGCTGTGTGTTCAAGCCAACCAGGCCCTTTCGC
ATTGTCACGTGCGGCGAGGATTTCTTGGTCAATTTCTATGAAGGGCCACCTTTCAAATTCAAGCAGTCTCACAGGGATCA
CTCGAATTTTGTGAACTGCGTGAGGTACTCTCCGGATGGGAGTAAGTTTATTACTGTAAGCTCGGATAAGAAGGGGCTTA
TTTTTGATGGGAAGACTGCGGAGAAGATCGGTGAGCTTTCGTCGGAAGATGGCCACAAAGGCAGCATTTATGCTCTTAGC
TGGAGTCCTGATGGCAAACAGATTCTGACTGTGTCTGCTGACAAGACGGCAAAAATATGGGATATATGTGAGGATTACCA
TGGGAAGGTGCATAAAACGTTGACATGTCCTGGATCAGGTGGAGTGGAGGACATGCTAGTTGGCGGCCTATGGCAGAATG
ATCATATAGTTACTGTTTCACTTGGAGGCATGATTAGTATATTCTCAGCAAGTGACCTTGATAAAGCCCCATTATCGCTA
TTTGGACACATGAAGAATGTTACTTCATTGTCTGTTCTGAAGAATGACCCAAAAGTTATATTGTCTACCAGCTATGATGG
TTTGATTGTTAAATGGATTCAAGGCGTTGGATATAGTGGAAAATTACAAAGGAAGGAGACCTCACAAATAAAATGCTTTG
CAGCTGTTGAAGAAGAAATTGTTACATCTGGATTCGACAATACAGTGTGGAGAGTTCCCTTAAATGGTGATCAATGTGGA
GATGCAGAATCTATTGATGTTGGTAGTCAGCCAAAGGACATAAGCCATGCCCTTCATTATCCTGAACTCGTTTTGGTTTC
AACTGATTCAGGAGCTCTCTTGCTTCGTGGCGGCAAAGTAGTGTCAACTATAAACCTTGGGTTTACTGTCACAGCATCTG
CAATTGCACCAGATGGTAGTGAAGCTATCATTGGTGGGCAGGATGGTAAACTGCACATTTATTCTATAGCAGGCAATACA
CTTACGGAAGAGGCTGTACTAGAGAAACATCGGGGTGCTATTAGTGTCATACATTACTCTCCAGATGTTTCAATGATTGC
ATCAGGAGATTTGAACCGAGAAGCTGTCATCTGGGATCGTGCCTCCCGAGAGGTCAAGCTTAAGAACATGCTGTACCATA
CTGCTCGAATAAACTGCCTTGCGTGGTCTCCTGATAACAGCATGGTCGCTACTGGATCACTTGACACTTGTGTCATTATA
TATGAAGTTGACAAGCCTGCATCAAGCCGTGTAACCATAAAGGGCGCTCATTTGGGCGGGGTATATGGGATAGCTTTCAC
CGATGAGCACACAGTGGTAAGCTCTGGCGAGGATGCGTTTGTTCGTGTTTGGAAGTTGACTCCCCAATAG