Details for Strawberry Locus mrna09404

Position : LG5 ( 5`- 10164528 .. 10170197 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09404

Protein [Map View]
MKAFCQLVLLVTLLIISGVLPSCVSQTTRRFEFNVEWKNVTRLCHKKPLLTVNGEYPGPTIAVHEGDNVEIKVTNRIAQN
TTIHWHGIRQIRTGWADGPAYITQCPIREGKTYTYKFTVIDQRGTLWWHAHHSWQRASVYGAFIIHPRTPYPFSVPIQDE
FPIIFGEWWNGDIDSVESEMMKYGGGPAISNAYTINGLPGPFYNCSNKDTLIKTVEHGKTYMLRIINAALNDELFFAVAN
HTLTVVEIDAVYTKPFKTKAIMIAPGQTTNVLLTANQVPDSSGMFLMVAWTYLTSVFPFNNSTTAGFLQYKNLMSTEHTS
QHPNKVTTFDPVMYNFPQMEDTKYYTKFSDNLRSLHSPRYPCNVPKTIHKRIVAVISLNLQDCPANKTCKGYANKRFFAS
MNNQSFVRPALSILESHYKKLKTSQYSTDFPEKPRKPFDYTGVDPLTENMNTEFGTKIMQVPYGTNLEIVLQGTSFLNVE
NHPIHVHGHNFFIVGKGFGNFDVSKDPAKYNLVDPPERNTVAVPSGGWAAIRIKADNPGVWFIHCHLEEHTSWGLASGFI
VQNGHGPSESLLPPPKDLPSSKPVPTLPSFYLTFICSNTPHTSPPSLLLQPSSFHTLTHPPLPLTHIAENPKSKLNKPTM
SPNPPPLFPFLCLLFTLLPSSLALTNPDPAAVQPFLPKSSPPATIPAFPEQSDIAGCPLQLPDELFHGVKAACSAKKGDP
AGHLQHSRCCPVLAAWLYSAYSATALGRSGRVGPAVTGHGSNTTTAYDPPLLPDDSETCVQDLGKALSAKGIELMRPNET
CDMVYCNCGIRLHPLSCPEAFSVNQNGKLIGDKSVKKLEKNCLSSSNNVNNFPGLGGCSKCLNSLKLLNKKKTSNSSKLE
DRTTKMHNKDCQLMGLTWLLAKNRTAYMHTVTSVFRAIMVSNDGSDPQSCTLNSDGMPLAVDSSEISDQSPSNILAVSFT
FCVVSLSLLYVQLTMS*

DNA
ATGAAGGCTTTCTGCCAGTTAGTACTATTGGTAACTCTATTGATCATATCTGGGGTTCTACCATCTTGTGTTTCGCAAAC
AACGCGGCGCTTTGAATTTAATGTTGAGTGGAAAAATGTGACCCGTTTGTGTCACAAAAAGCCACTTCTAACTGTTAATG
GAGAGTATCCAGGTCCAACGATTGCTGTTCATGAAGGTGATAATGTCGAAATTAAGGTGACTAATCGCATTGCGCAGAAC
ACTACCATTCATTGGCATGGTATAAGGCAAATTAGAACAGGATGGGCAGACGGTCCAGCTTACATTACGCAATGTCCAAT
CAGAGAAGGGAAGACCTACACATACAAGTTCACTGTAATTGATCAGAGAGGCACCCTTTGGTGGCATGCTCATCATTCGT
GGCAACGAGCTTCAGTTTATGGAGCCTTTATCATCCACCCTCGCACGCCGTATCCATTTTCAGTTCCAATTCAAGATGAA
TTCCCCATCATCTTTGGTGAATGGTGGAATGGAGATATAGATTCAGTGGAAAGTGAAATGATGAAGTATGGAGGCGGCCC
TGCCATTTCAAATGCCTATACCATAAACGGTTTACCTGGACCATTCTATAATTGCTCAAACAAAGATACATTGATCAAAA
CTGTGGAACATGGCAAAACATACATGCTTAGAATCATCAATGCAGCACTGAATGATGAGCTTTTCTTTGCTGTTGCTAAT
CACACATTGACGGTTGTGGAGATTGATGCAGTGTACACAAAACCATTCAAAACCAAAGCCATCATGATAGCTCCTGGCCA
AACCACCAATGTTCTTCTCACTGCTAATCAAGTGCCTGATTCCTCAGGCATGTTCTTAATGGTTGCCTGGACTTACCTCA
CATCTGTTTTTCCTTTCAATAATTCCACCACAGCGGGTTTCTTGCAGTACAAGAACCTGATGAGTACTGAACACACGAGT
CAGCACCCGAATAAGGTCACTACTTTTGATCCTGTCATGTACAACTTTCCTCAGATGGAAGACACCAAATATTACACTAA
ATTTTCTGACAACCTGAGAAGCCTTCACTCCCCTCGGTATCCATGTAATGTGCCGAAAACTATCCACAAACGGATAGTAG
CAGTTATAAGCCTTAACCTTCAAGATTGTCCTGCTAACAAAACCTGCAAGGGCTACGCCAACAAGAGGTTCTTTGCTTCA
ATGAACAACCAGTCATTTGTTCGTCCCGCCTTGTCAATATTGGAATCTCATTACAAGAAGCTCAAAACAAGCCAATACTC
CACCGATTTCCCAGAGAAGCCTCGAAAGCCATTTGACTATACCGGGGTGGATCCACTCACAGAAAACATGAACACAGAAT
TTGGTACCAAGATCATGCAAGTCCCCTATGGAACAAACTTGGAAATTGTGCTGCAAGGCACAAGCTTCCTTAATGTGGAG
AACCACCCCATTCATGTACATGGACACAACTTCTTCATAGTTGGTAAGGGGTTTGGGAACTTTGATGTCTCCAAGGATCC
AGCAAAGTACAACCTTGTTGATCCTCCTGAGAGAAACACAGTAGCAGTACCAAGTGGAGGATGGGCCGCGATTCGGATCA
AGGCTGATAATCCAGGAGTGTGGTTCATACATTGTCATCTTGAAGAACACACTTCCTGGGGTCTTGCCTCAGGCTTCATA
GTTCAAAATGGTCATGGACCATCTGAATCCTTGCTTCCTCCTCCCAAGGATCTTCCCTCATCCAAACCAGTCCCAACCCT
ACCATCCTTTTATCTCACTTTCATTTGCTCCAACACTCCCCACACCTCCCCACCATCACTTTTGCTTCAGCCATCATCCT
TTCACACTCTCACTCACCCCCCTCTTCCCCTCACACACATTGCAGAAAACCCAAAATCCAAACTCAACAAACCCACAATG
TCCCCAAACCCACCTCCCCTCTTCCCCTTCCTTTGCCTCCTCTTCACTCTCTTACCCTCCTCACTGGCACTAACCAATCC
GGACCCGGCTGCAGTGCAGCCATTCCTTCCTAAATCTTCTCCCCCAGCTACAATCCCTGCATTCCCAGAGCAATCCGACA
TAGCCGGCTGCCCACTCCAGCTCCCTGATGAGCTCTTCCACGGCGTAAAGGCCGCCTGCTCAGCCAAAAAAGGCGACCCG
GCTGGCCATTTACAGCACAGCCGCTGCTGCCCTGTGCTCGCGGCGTGGCTCTACTCGGCCTACTCTGCCACCGCATTGGG
CAGAAGCGGCCGAGTAGGGCCTGCAGTAACGGGTCACGGTAGTAATACTACTACCGCGTATGACCCGCCACTGCTGCCTG
ATGACTCGGAAACTTGTGTTCAGGACTTGGGAAAAGCGCTGAGTGCAAAGGGAATAGAGCTGATGAGACCAAACGAGACC
TGTGACATGGTGTACTGCAACTGTGGGATCAGATTGCATCCTTTGAGCTGCCCTGAGGCATTTTCAGTGAACCAAAATGG
GAAACTTATTGGGGATAAGAGTGTCAAGAAGTTAGAGAAGAACTGCTTGAGCAGCAGCAACAATGTCAACAATTTCCCTG
GTCTTGGTGGCTGCTCCAAATGCCTCAACAGTCTCAAACTTCTTAACAAGAAGAAGACTTCCAATTCAAGCAAATTGGAG
GACAGGACCACCAAAATGCACAACAAAGATTGTCAGCTGATGGGTCTCACATGGCTCCTTGCCAAGAATCGGACGGCCTA
CATGCACACCGTTACATCCGTCTTCCGGGCTATCATGGTAAGCAACGACGGCTCCGATCCTCAGTCGTGCACCCTCAACA
GTGACGGAATGCCTCTAGCTGTCGATTCGTCGGAAATCTCTGATCAGTCCCCCTCCAACATCCTTGCAGTTTCATTCACA
TTCTGCGTAGTGTCACTTTCTCTGTTGTATGTGCAGCTTACCATGAGCTAA