Details for Strawberry Locus mrna09397

Position : LG5 ( 5`- 10128456 .. 10134265 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09397

Protein [Map View]
MDPPPPPPNLYPPPPISAVPTTVEPVNNNIAPITYAAANPTHAPAPTFNHPPYAEMIYTAIAALKERDGSSRRAIAKYIE
QVYPSLPPTHSALLTHHLKRLKNSGHLEMVKKSYKIPGPPRSDAAAPPPFPIDSPAPASAASPAQPRGRGRPPKPKPDHQ
QLMQQQLPQLIAPQQHQHILQQPIPIPQQPIPIPLPQQPISFPIPQQPISISYPQQPIPIPMPIPIPQMPIPIPQHPIVP
PNFQSFPQPTLPQTFPEPIPQQQPNSLPMVVSPGPADVPKKRPGRPRKAPAALAIVQNNSPVVKRGRGRPPGSRMSKKRP
GRPPKPKTVSVSGPNGLVKRRPGRPSKAEPRSVFIPYATNVPIIGAFEQSNGPNSVVPLPAPRPRGRPKKDKSAAASSGV
AAGTGKPRGRPPLVPGVDRPKLSRSGRPVGRPKKDATLAITAAPDPNIAANAELKRKLEYFQSRVGQAVGVLKPFLNNES
AVDAAAAIQELEGLATMDMSAPLIIATEQPALQSLKVLWNERVAYSMPNLVAWGMLDVYIVVALMILVRIMGVGNSTPNS
LCEFGLDNAMTAIPPHSMAAAICSPRASKSLINTALRITGNSELANPFLNAAKRVRSTFSQSSWPPEYFEE*

DNA
ATGGACCCACCTCCTCCTCCTCCCAATCTTTATCCACCGCCGCCCATCTCCGCCGTCCCAACCACCGTGGAACCTGTTAA
CAACAACATCGCCCCCATCACTTATGCAGCTGCCAACCCAACTCACGCTCCCGCCCCTACTTTCAACCACCCTCCTTATG
CTGAGATGATATACACAGCTATAGCAGCGTTGAAGGAGAGAGACGGGTCGAGCAGGAGAGCTATAGCTAAGTACATCGAG
CAGGTCTACCCGAGCCTCCCACCTACTCACTCAGCCTTGTTGACTCACCATCTCAAGCGCCTCAAGAACTCAGGTCATCT
TGAGATGGTCAAGAAGTCCTACAAGATCCCTGGTCCTCCCAGATCTGACGCTGCTGCTCCTCCTCCTTTTCCTATTGACT
CTCCTGCTCCTGCCTCAGCTGCCTCTCCTGCACAGCCACGTGGCCGAGGCCGTCCTCCCAAGCCCAAGCCGGACCACCAG
CAGCTGATGCAGCAACAGTTGCCACAGCTGATTGCTCCCCAACAACACCAGCACATTTTACAACAACCCATTCCCATTCC
GCAACAGCCGATTCCAATTCCGCTTCCTCAGCAGCCAATTTCATTTCCGATTCCTCAGCAGCCAATTTCAATTTCATATC
CTCAACAACCGATTCCGATTCCGATGCCCATTCCGATTCCGCAAATGCCGATTCCCATTCCCCAGCACCCCATTGTCCCG
CCCAATTTCCAATCTTTTCCACAGCCCACACTGCCGCAGACCTTTCCGGAGCCCATTCCTCAGCAGCAGCCCAATTCTCT
GCCCATGGTGGTTTCTCCGGGGCCGGCAGATGTGCCCAAGAAGCGACCTGGCCGGCCACGTAAAGCTCCGGCAGCCCTTG
CGATCGTGCAGAATAATAGTCCGGTAGTGAAGAGGGGCAGGGGCCGTCCTCCGGGGTCTAGGATGTCAAAGAAGAGACCA
GGACGTCCTCCCAAACCCAAGACGGTGAGTGTTTCGGGTCCTAATGGACTTGTGAAGAGGAGACCAGGGCGTCCCTCCAA
AGCTGAGCCGAGGAGTGTGTTTATTCCATATGCTACTAATGTGCCTATTATTGGGGCATTTGAGCAGAGCAACGGGCCCA
ATTCAGTAGTGCCACTGCCTGCACCGAGGCCCAGAGGTCGGCCCAAGAAGGATAAGTCGGCTGCTGCGTCTTCTGGTGTG
GCTGCGGGCACTGGTAAGCCGCGGGGCAGACCACCTCTGGTTCCGGGGGTGGACCGCCCCAAGTTAAGTAGGAGTGGAAG
GCCTGTGGGCAGGCCCAAGAAGGATGCAACACTGGCAATAACTGCAGCACCTGATCCAAATATAGCTGCAAACGCAGAAT
TGAAGAGGAAACTGGAATACTTTCAATCAAGAGTGGGTCAAGCTGTTGGTGTGCTAAAACCTTTCTTGAATAATGAAAGC
GCAGTTGATGCCGCTGCTGCAATCCAAGAATTAGAAGGACTAGCAACCATGGACATGAGTGCCCCGTTAATTATTGCAAC
TGAACAGCCAGCACTCCAAAGCTTAAAAGTGTTATGGAATGAGCGTGTAGCGTATTCCATGCCGAATCTTGTGGCATGGG
GAATGCTCGATGTTTATATTGTTGTAGCTTTGATGATACTTGTCAGGATCATGGGTGTTGGAAACTCCACTCCGAACTCC
CTTTGCGAGTTTGGATTGGATAACGCCATGACTGCTATCCCTCCCCACTCTATGGCAGCCGCTATTTGTTCTCCACGCGC
CTCCAAAAGTTTGATCAACACTGCTTTGAGGATCACGGGGAATTCGGAGCTAGCAAACCCATTTTTGAACGCAGCGAAAC
GGGTCAGATCAACCTTCTCTCAGTCCTCCTGGCCTCCAGAATATTTTGAAGAATAG