Details for Strawberry Locus mrna09391

Position : LG5 ( 5`- 10099433 .. 10101481 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09391

Protein [Map View]
MYLTTLPSPKTPITPKTLTIPLTFFFTHYSTSASHLDQISVDNTPYWTKTIHHLCTRHRNVDQALHLLDHLHLRGYRPVP
LNLTSIVHALCDSHRFDEAHHRFANSIHSDCVPDQRTCNVIIARLLDSQTPHTTLNVLRLLSHLKPDFVASLVNYNRLMD
QLCSLRRPSEAHTVLFDMMSRGHCPNAVSYTTLINGYCGMGELSHAHKVFDEMCEREVAPNSMTYSVLISGVLRKRDIRG
AVEMMGKLWEAMKGEDDTLVKNAAFSNLIESMCREGYFQEVFGIAEDRPQGESVNEEFAYGQMIDSLCKAGRYHGASRIV
YIMRHRGFVPRVTSYNCIVHGLTKEGEGGVMRAYQLLEEGIEFGYLPSEYTYKVLVEGLCQESDVDKAWQVLQYMLRKER
VDKTRMYNIYLRALCLANNTTELLNTLVSMLQTECQPDVITLNIVVNGFCKMGRVEEALKVLDDMMTGKFCAPNVVTFTT
IINGLLNVGRTQEALYILHDVMPQKGFRPNVVTYNAVLRGLFKLDQGKQAMEIFNGMVTEGVAASSTTYTIIIDGLCESD
QLEEAKRFWDDVIWPSQIHDNFVYAAIIKGICHSGNFDEACHFLYELVDSGVSPNIFSYNIVIDTACKLGLKKEAYEVVR
EMKRNGLSPDSVTWRILDKFHGNARKEFGDDEDSQSRSRPHG*

DNA
ATGTACCTCACAACTCTACCCTCACCCAAAACCCCAATCACCCCCAAAACCCTAACCATCCCCCTCACCTTCTTCTTCAC
ACACTACTCCACCTCAGCCTCTCACCTCGACCAAATCAGCGTAGACAACACACCCTACTGGACCAAAACCATCCACCACC
TCTGCACCCGCCACCGCAATGTCGACCAAGCCCTCCACCTCCTCGACCACCTCCACCTCCGTGGCTACCGCCCCGTCCCC
CTCAACCTCACCTCCATCGTACACGCTCTCTGCGACTCCCACCGCTTCGACGAAGCCCACCACCGCTTTGCCAACTCCAT
CCACTCCGATTGCGTCCCTGACCAGCGCACTTGCAACGTCATCATCGCTCGCCTCCTCGATTCCCAAACCCCGCACACCA
CCTTAAATGTTCTTCGCCTCTTGAGTCATTTAAAGCCTGATTTCGTTGCCTCTTTGGTCAATTACAACCGTCTGATGGAT
CAGCTCTGCTCGCTCCGGCGGCCCAGTGAGGCTCATACAGTACTATTTGATATGATGAGCAGAGGGCATTGCCCGAATGC
GGTTTCCTATACAACGTTGATCAATGGGTACTGCGGAATGGGCGAGTTAAGTCATGCACACAAGGTGTTTGATGAAATGT
GTGAGAGAGAAGTAGCGCCTAATTCGATGACTTATAGTGTTTTGATTAGTGGAGTTCTTCGGAAGCGGGATATTCGGGGT
GCGGTGGAAATGATGGGGAAGTTATGGGAGGCAATGAAGGGTGAAGATGACACTCTTGTGAAAAATGCTGCTTTTTCGAA
TTTGATTGAGTCCATGTGTAGAGAAGGGTATTTTCAAGAAGTTTTCGGTATTGCGGAAGATAGGCCGCAGGGGGAGAGTG
TGAATGAGGAGTTTGCTTATGGGCAGATGATCGATTCGCTTTGTAAAGCCGGAAGATATCATGGGGCGTCGAGGATTGTG
TACATCATGAGGCATAGAGGGTTTGTGCCACGCGTAACGTCGTATAATTGTATTGTGCATGGACTGACCAAGGAAGGAGA
GGGAGGTGTTATGAGGGCTTACCAGTTGTTAGAGGAAGGAATTGAGTTTGGTTACTTGCCGTCGGAGTACACTTACAAGG
TTCTAGTGGAAGGTCTGTGCCAAGAATCAGACGTTGACAAGGCGTGGCAAGTTCTTCAATATATGTTGAGGAAGGAAAGA
GTGGACAAAACCAGGATGTATAATATATATTTGAGAGCTCTGTGTCTTGCTAATAACACTACTGAGCTCTTGAACACGCT
TGTTTCGATGCTCCAGACAGAATGTCAGCCTGATGTGATCACGCTGAACATTGTTGTCAATGGGTTCTGCAAGATGGGGA
GAGTGGAAGAAGCTTTAAAGGTACTGGATGATATGATGACCGGAAAATTTTGCGCGCCAAATGTAGTGACCTTCACAACT
ATCATAAATGGTTTGTTAAATGTTGGTAGAACGCAAGAAGCTCTTTATATACTGCATGATGTGATGCCTCAGAAAGGTTT
TCGCCCTAATGTTGTGACATATAATGCTGTTCTTCGTGGTTTGTTCAAACTTGATCAAGGAAAGCAAGCAATGGAGATTT
TTAATGGCATGGTAACTGAGGGTGTGGCTGCTAGCAGTACCACTTACACTATTATTATTGATGGGTTATGTGAGTCTGAT
CAGCTAGAAGAGGCTAAAAGGTTTTGGGATGACGTTATTTGGCCCTCACAGATCCATGACAATTTTGTATATGCGGCCAT
CATCAAAGGGATCTGCCATTCAGGAAATTTTGATGAGGCATGTCATTTCCTTTACGAACTTGTAGACTCTGGGGTCTCTC
CGAATATATTCAGTTACAACATTGTGATCGACACTGCTTGCAAATTAGGTCTCAAGAAAGAGGCCTATGAAGTCGTAAGA
GAGATGAAAAGAAATGGGTTGTCTCCAGATTCTGTAACATGGAGGATTCTTGATAAGTTTCATGGGAATGCAAGGAAAGA
ATTTGGGGATGATGAGGATTCACAATCAAGAAGTCGACCGCATGGATAG