Details for Strawberry Locus mrna09389

Position : LG5 ( 5`- 10088689 .. 10090852 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09389

Protein [Map View]
MWMMGYNDSSDFNMIPDSAFNGRKIRPLVPRTHNNNNNNNSSTSTHVPPCFSRIHAASDFLAQYHQLGEQRGMREFNTVP
QVVVSSRWNPTPEQLRALEELYRRGTRTPSAEQIQQITAQLRRFGKIEGKNVFYWFQNHKARERQKRRRQMESHDDLQLM
CSADHQKKESLGGASRTVYEVEETKNWAPSTNCMTTSLQDHLHHHQQETVKAGAEENRTEGWVQFDEEELQQLQQQQRRN
SMPVEKNATWQMMQLSCPPPPPSVPSLHDLTHLINAPTCPRATVRTMGMDQKQLINNPNNKTSPPHDLSIFIAPCRSGAA
LNGRHLLHHHHSVEDEDQTQTLELFPLRSNTCGEKSHLAAEKSSLNPSFGTGPNYQFFEFLPLKN*

DNA
ATGTGGATGATGGGATACAATGATAGTAGTGACTTCAATATGATTCCGGATTCCGCCTTCAACGGTCGGAAGATTCGTCC
TCTCGTTCCCAGGACGCACAACAACAACAACAACAACAACAGTTCAACAAGCACACATGTTCCGCCTTGTTTCAGTCGAA
TTCACGCTGCGTCTGATTTCTTAGCACAGTATCACCAGCTGGGTGAACAAAGAGGGATGAGGGAGTTCAACACAGTGCCT
CAGGTAGTGGTGAGCTCGAGATGGAACCCCACGCCGGAGCAGTTGAGGGCACTAGAAGAGTTATATCGACGAGGGACTCG
AACTCCATCGGCTGAGCAGATTCAGCAAATCACTGCTCAGCTTCGAAGGTTTGGAAAGATTGAGGGAAAGAACGTGTTCT
ATTGGTTCCAAAACCACAAGGCAAGAGAGAGGCAGAAACGCCGTCGCCAGATGGAATCTCACGACGACCTTCAACTCATG
TGTTCCGCAGATCACCAAAAGAAGGAATCATTAGGCGGAGCAAGTAGGACAGTGTATGAAGTTGAAGAGACCAAGAATTG
GGCACCCTCTACAAACTGCATGACTACTAGTCTCCAAGATCATCTGCATCATCATCAACAGGAAACAGTAAAAGCAGGAG
CAGAAGAAAACAGGACGGAAGGATGGGTCCAATTCGATGAGGAAGAATTGCAGCAACTTCAACAACAGCAAAGAAGGAAT
TCCATGCCTGTGGAAAAGAATGCCACTTGGCAGATGATGCAGTTGTCTTGTCCTCCTCCTCCTCCTTCTGTTCCTTCTCT
TCATGACCTCACCCACCTCATAAACGCACCCACTTGTCCTAGAGCGACAGTAAGAACAATGGGGATGGACCAAAAGCAGC
TCATCAATAACCCTAACAATAAGACTAGTCCTCCTCATGATCTCAGCATCTTTATAGCTCCCTGCAGGTCCGGCGCTGCC
CTTAACGGTCGCCATCTCCTCCACCACCACCACAGTGTCGAAGATGAAGATCAGACTCAAACGCTCGAGCTCTTTCCGCT
CCGGAGTAATACTTGCGGCGAGAAAAGCCATCTTGCAGCTGAGAAATCGTCACTGAATCCTAGTTTCGGCACTGGCCCTA
ATTACCAGTTTTTCGAGTTCCTCCCATTGAAGAACTGA