Details for Strawberry Locus mrna09386

Position : LG5 ( 5`- 10073510 .. 10077459 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09386

Protein [Map View]
MPGGKCIYKETGPREQLKGTEKSEKEESERLRWRLNAAEREIREPQIKELFQITHCRKEREIQKSYWEENSTELTVESMM
LDSKASDLDKEERPEVLAMLPPYEGKSVLELGAGIGRFTGELAQKAGQLIAMDFIENVIKKNESINGNHKNVKFMCADVT
SPDLKISEESVDLIFSNWLLMYLCDKEVENLAARMMKWLKVGGYIFFRESCFHQSGDCKRKYNPTHYREPRFYSKVFKQC
HMRDESGNYFELSLISCKCIGAYVRNKKNQNQICWIWQKVASHNDRGFQQFLDNVQYKSNGILRYERVFGPGFVSTGGLE
TTKEFVAKLELKPGQKVLDVGCGIGGGDFYMASTFDVEVVGIDLSVNMISFALEQSIGLKCAVEFEVADCTTKTYPDNSF
DVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCRSAGTPSAEFAEYIKQRGYDLHDVKAYGQMLTDAGFVDVVAE
DRTDQFIRVLQRELNAVEKDKEAFIKDFSEEDYNDIVGGWKAKLVRTNSGEQKWGLFIAKKK*

DNA
ATGCCCGGAGGCAAGTGTATCTATAAGGAGACTGGTCCGAGGGAGCAACTGAAAGGCACTGAGAAATCGGAGAAGGAAGA
GAGTGAGAGGCTGAGGTGGAGGCTTAATGCAGCAGAGAGGGAGATCAGAGAACCGCAGATCAAGGAGCTTTTCCAGATCA
CGCATTGCCGAAAAGAGCGTGAGATACAGAAGAGCTACTGGGAGGAGAACTCGACGGAATTGACGGTTGAGTCTATGATG
CTGGACTCCAAGGCCTCCGATCTTGACAAAGAAGAGCGGCCTGAGGTGCTTGCCATGCTCCCGCCCTATGAGGGTAAATC
GGTCTTGGAACTGGGAGCTGGGATCGGTCGTTTCACTGGCGAATTAGCCCAGAAGGCTGGTCAGCTCATTGCGATGGACT
TCATTGAAAATGTGATAAAGAAGAATGAAAGCATCAATGGAAACCACAAGAACGTCAAGTTCATGTGTGCTGATGTGACA
TCCCCTGACCTGAAGATATCTGAAGAATCAGTAGATTTGATTTTCTCAAACTGGCTTCTTATGTATCTATGTGATAAGGA
GGTGGAGAATTTGGCAGCAAGGATGATGAAATGGTTGAAGGTCGGTGGGTACATTTTCTTCAGAGAATCTTGTTTCCACC
AATCTGGGGACTGTAAGCGAAAATACAACCCAACCCATTACCGAGAACCCCGATTTTACAGCAAGGTGTTTAAGCAATGC
CATATGCGTGACGAATCTGGGAATTACTTTGAACTCTCTCTTATAAGCTGCAAATGTATTGGAGCTTATGTTCGGAACAA
AAAGAATCAAAATCAGATTTGCTGGATATGGCAGAAAGTCGCTTCCCACAATGATAGAGGGTTCCAGCAGTTCTTAGATA
ATGTCCAGTATAAGAGTAATGGAATATTACGATATGAGCGTGTCTTTGGGCCGGGATTTGTGAGCACAGGAGGCCTTGAG
ACAACTAAGGAATTTGTGGCAAAGTTGGAACTTAAGCCTGGCCAGAAAGTTTTAGATGTTGGCTGTGGAATTGGGGGAGG
TGACTTTTACATGGCCAGTACCTTTGATGTTGAGGTTGTTGGCATTGACCTCTCTGTAAACATGATTTCCTTTGCCCTTG
AACAATCCATTGGACTCAAATGCGCTGTCGAGTTTGAAGTTGCGGATTGCACCACAAAAACATATCCAGACAACAGCTTT
GATGTGATATACAGCCGCGACACCATTTTACACATTCAAGACAAGCCTGCATTATTCCGATCCTTTTACAAGTGGTTGAA
GCCTGGAGGTAAAGTTCTCATCACTGACTACTGTAGGAGTGCTGGAACTCCGTCTGCAGAATTTGCCGAGTACATAAAGC
AAAGAGGATATGACCTCCATGATGTAAAAGCATATGGTCAGATGCTTACGGATGCTGGTTTTGTTGATGTCGTTGCTGAG
GATCGTACTGATCAGTTCATAAGAGTTCTGCAGCGGGAATTAAATGCCGTTGAGAAGGACAAGGAGGCATTCATCAAGGA
CTTTTCTGAAGAGGACTACAATGACATCGTTGGTGGATGGAAGGCAAAGCTGGTCAGGACAAACTCAGGAGAGCAGAAGT
GGGGCCTCTTCATTGCCAAGAAGAAATGA