Details for Strawberry Locus mrna09383

Position : LG5 ( 5`- 10049861 .. 10053515 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09383

Protein [Map View]
MRYFVGLSRLRSASFYDRIPTTNDVDWVPGAVDQTQTTVDRAPTTVDGAPTTGQYGGLLEAICMGYVWGSTGGNRGFVMG
SIGAGKRNPGRDRLDGSVFEEVLVKGELGEVGEGGFSSVGLDEGGRMTDSPGGRGSKSLMENLLGLLRIRVKRGVNLAVR
DVRSSDPYIVIKMGKQKLKTRVIKKDVNPEWNEDLTLSVTDPSIPVKLTVYDHDTFSKDDKMGDAEFDIVPYIEALKMDY
GGIPSGTIITRVQPCRQNCLSEESCVRWSEGKVIQDLCLRLRNVECGEVEIQLQWIDLPGSKGLS*

DNA
ATGAGGTACTTTGTTGGTTTATCGAGGCTTCGTTCCGCAAGTTTTTATGACCGGATTCCCACAACCAATGACGTTGACTG
GGTTCCGGGCGCAGTTGACCAGACTCAGACGACTGTTGACCGGGCTCCAACGACCGTTGACGGGGCTCCGACAACTGGGC
AGTATGGGGGTCTTTTGGAGGCAATATGCATGGGGTATGTCTGGGGGTCTACTGGGGGCAATAGGGGGTTCGTCATGGGG
TCAATTGGGGCTGGAAAGCGCAATCCAGGCAGAGATCGGCTCGACGGCAGCGTCTTCGAAGAGGTTCTGGTGAAAGGAGA
GCTTGGTGAGGTTGGAGAGGGTGGGTTTAGCTCGGTGGGACTCGACGAGGGAGGGAGGATGACGGACTCACCTGGTGGTC
GAGGGTCGAAATCTCTCATGGAGAATCTGCTCGGTCTTCTCCGCATCCGCGTCAAGCGCGGCGTTAACCTCGCCGTCCGC
GACGTCCGTAGCAGCGATCCTTACATCGTTATCAAGATGGGCAAACAGAAACTGAAGACTCGTGTGATTAAAAAGGATGT
TAATCCAGAGTGGAATGAAGATCTTACTCTTTCTGTTACGGACCCTTCTATTCCAGTCAAGCTGACTGTGTATGATCACG
ATACGTTCAGCAAGGATGATAAAATGGGGGATGCAGAGTTCGACATAGTACCTTATATTGAGGCATTGAAGATGGATTAT
GGAGGCATCCCAAGCGGCACGATTATAACAAGAGTACAACCTTGCAGGCAAAACTGCCTATCTGAGGAGAGCTGCGTCCG
CTGGAGCGAAGGCAAGGTCATCCAAGATCTCTGTCTCAGATTGAGAAATGTGGAATGCGGTGAAGTTGAAATCCAGTTGC
AGTGGATCGATCTTCCTGGTTCCAAGGGCTTATCATGA