Details for Strawberry Locus mrna09373

Position : LG5 ( 5`- 10000068 .. 10005442 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09373

Protein [Map View]
MSSRFDIEGHVTGFGHPDWAKTHDPASRTAPVVSTLVQGGATCIGKTVVDELAYSISGENEHYFTPTNPTAPSKTPGGSS
SGAAVAVAANLADFSLGLDTVGGVRVPAAFCGIMGFRPSHGAVSHSGVLPVSTSLDTVGWFAKDPKVLGRVGHVLLQLPF
ASSRSPRQIVIADDCLQQVKVPTDRIAQVVVKSTEKHFGRQVLKHENLDNYFNLKVPSLRKFHGEKTNGVVKVSSIKLLA
HVAQSLQRHEFKQNHDEWINLVKPTLDPATSAQLCGPPESSDMEVEICKSIKNELHAAVNALLKDDGILVIPTVADPPSK
LGGKPLLSEDFRSRAFGLLSIASLSGCCQVTIPLGLHNKNPVSVSFIARHGGDRFLLDTLQTMYTSLQEQADLVTNTKLS
KNALTREQSAEVSKEKGNQAFKAKEYQKAIGFYSEAIKLSGNNATYYSNRAAAYLEIGSFLQAEADCSQAINLDKKNVKA
YFRRGTAREVLGYYKEAIEDFKYAHVLEPTNKRAAAAAERLRKLFVQ*

DNA
ATGTCTAGCAGGTTTGATATAGAGGGACATGTAACTGGATTCGGTCATCCTGATTGGGCAAAAACACATGATCCGGCTTC
TCGGACAGCTCCTGTGGTTTCCACACTTGTCCAAGGAGGAGCCACATGCATTGGAAAAACTGTTGTGGACGAATTGGCAT
ATAGCATTTCTGGAGAAAATGAGCATTACTTTACACCTACCAACCCTACAGCTCCATCAAAAACACCAGGTGGATCCTCT
AGTGGAGCTGCTGTGGCTGTGGCAGCTAATCTTGCTGACTTTTCCCTGGGTCTTGATACTGTTGGTGGTGTTAGAGTACC
TGCGGCATTTTGTGGCATTATGGGTTTCCGACCTTCGCATGGGGCTGTTTCTCACAGTGGAGTTTTACCTGTTTCGACAA
GTCTTGATACTGTTGGATGGTTTGCGAAGGATCCTAAGGTTCTAGGTCGAGTTGGTCATGTGTTGCTGCAACTTCCTTTT
GCATCTTCACGTAGTCCAAGACAAATTGTGATAGCTGATGATTGCCTACAACAAGTAAAGGTTCCTACAGACAGGATTGC
TCAAGTAGTTGTCAAATCCACTGAGAAGCATTTTGGAAGACAAGTATTGAAGCATGAAAATCTTGACAACTATTTCAATT
TAAAAGTTCCAAGCTTGAGAAAATTTCACGGTGAGAAGACAAATGGTGTTGTAAAGGTTTCATCAATAAAACTGCTTGCT
CATGTTGCACAGTCTCTTCAAAGACATGAATTCAAACAAAATCATGATGAATGGATTAATTTGGTGAAGCCTACTTTGGA
TCCTGCTACTTCAGCTCAATTATGTGGGCCACCAGAGTCATCAGATATGGAGGTTGAAATCTGCAAGTCTATTAAAAATG
AATTGCATGCAGCTGTCAACGCTCTATTGAAGGATGATGGGATTCTGGTGATCCCGACCGTGGCAGATCCTCCTTCAAAA
CTTGGTGGGAAGCCTCTCCTCTCTGAGGACTTCCGTAGTCGTGCTTTTGGTTTGTTAAGCATTGCAAGCCTATCAGGTTG
CTGTCAGGTCACAATACCACTTGGACTTCATAACAAGAATCCTGTTTCAGTTTCCTTCATAGCCAGGCATGGGGGTGATC
GCTTTTTATTAGATACACTGCAGACAATGTACACATCTTTACAAGAGCAGGCTGATCTTGTTACAAACACCAAATTATCA
AAAAATGCACTCACCAGAGAGCAATCTGCTGAAGTTTCCAAGGAAAAGGGAAACCAAGCATTTAAAGCCAAAGAGTATCA
GAAGGCTATTGGGTTTTATTCAGAAGCTATAAAACTTAGTGGCAATAATGCAACATATTACAGTAACAGGGCTGCAGCAT
ATCTGGAAATTGGAAGTTTTTTACAAGCTGAGGCAGACTGTAGTCAGGCTATCAACCTTGACAAAAAGAATGTGAAGGCT
TATTTCCGAAGAGGCACTGCGAGGGAGGTGCTTGGTTACTATAAGGAGGCAATTGAAGACTTTAAATATGCACATGTTCT
TGAACCAACAAATAAAAGAGCAGCAGCTGCTGCTGAAAGATTAAGGAAATTGTTCGTTCAGTAA