Details for Strawberry Locus mrna09366

Position : LG5 ( 5`- 9958919 .. 9959657 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09366

Protein [Map View]
MLDPRNDLLPPPSSPSNSSVSSSDLDTESTGSFFHDRSTTLGTLMGVSFPAITFRAPSQSRRELQSGGGTSGSGSRKTKK
PKKKSAAAAVAGVTERRRRWWRLCRDDGTKPASLGEFLEVERRFGDAAFYNTAAELEGVMVPQQPRNGGQMLFADGRVLP
PSNVDDGASSSTAGGLCRFPVSLTAICSGGLA*

DNA
ATGCTAGATCCAAGAAACGACTTGCTTCCTCCTCCTTCATCTCCCTCCAACTCCTCCGTCTCCTCCTCCGATCTCGACAC
CGAGTCTACAGGCTCGTTCTTCCATGATCGGAGCACCACCTTGGGAACCCTCATGGGAGTGAGTTTCCCGGCGATAACAT
TCCGAGCGCCGAGCCAGAGCCGCCGGGAGCTCCAGTCCGGCGGCGGCACCAGCGGCAGCGGCTCGAGGAAGACGAAGAAG
CCGAAGAAGAAGAGCGCCGCGGCGGCGGTTGCCGGAGTGACGGAGAGGCGGCGGAGGTGGTGGAGGCTCTGCCGAGACGA
CGGGACCAAGCCGGCGTCGCTGGGGGAGTTTCTGGAAGTGGAGAGGCGGTTCGGCGACGCCGCGTTTTACAATACGGCGG
CGGAGCTTGAAGGGGTGATGGTGCCGCAGCAGCCGAGGAATGGAGGACAAATGTTGTTTGCTGACGGGAGGGTTCTGCCG
CCGTCGAATGTGGACGACGGGGCTTCTTCGTCGACGGCCGGCGGGCTTTGTAGATTTCCGGTTTCTCTCACTGCCATCTG
TAGTGGCGGTTTAGCGTAA