Details for Strawberry Locus mrna09364

Position : LG5 ( 5`- 9951672 .. 9953558 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09364

Protein [Map View]
MASLPLGNTTNCSLLCERRPVSFMGISALPLTQLRIGAFAGLVRGRAATHSLCRKEMSLFWGKGSDGINKMKSKKVIFTI
PRSSSSNSNGGEENSPDNAKKQKSFGYSRKDVILIGVGVTALGVGLKSGLEFVGVDPLQAGNVVQLVLVLGLTIGWISTY
IFRVSNKEMTYAQQLRDYESAVMEKRLEGLTEAELEALLEQVDEEKRRLGEKVN*

DNA
ATGGCATCTCTTCCACTTGGAAATACTACAAATTGTAGCTTACTATGTGAAAGAAGACCCGTTTCGTTTATGGGCATCTC
GGCTCTTCCATTGACACAACTGAGGATTGGAGCTTTTGCTGGTTTGGTGAGAGGAAGAGCTGCAACACACAGCTTATGTA
GAAAGGAGATGTCCCTTTTCTGGGGTAAAGGTTCCGACGGAATAAACAAAATGAAGTCGAAAAAGGTGATCTTTACCATC
CCCAGAAGTAGTTCTTCGAACTCTAATGGGGGTGAAGAGAACTCCCCTGATAATGCCAAGAAGCAAAAATCTTTTGGATA
CTCAAGGAAAGATGTTATATTGATTGGAGTTGGAGTAACTGCACTAGGCGTTGGCTTGAAAAGTGGATTAGAGTTTGTAG
GAGTTGATCCATTACAAGCAGGAAATGTCGTTCAACTGGTACTGGTGTTGGGCCTTACGATTGGATGGATTTCCACTTAT
ATTTTTCGAGTTTCTAATAAGGAAATGACATATGCACAGCAATTGCGTGACTATGAAAGCGCAGTCATGGAGAAGAGGTT
AGAGGGCCTAACAGAAGCAGAACTAGAAGCGTTGCTTGAACAAGTTGACGAAGAGAAGAGGCGCCTTGGCGAGAAAGTCA
ACTAA