Details for Strawberry Locus mrna09363

Position : LG5 ( 5`- 9945210 .. 9950436 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09363

Protein [Map View]
MAIVTGDRYLEKLVQFVEKHAGSLIDGSLVLKLNPAGFHYVHSRLEALHELESLLAGAPVDYLRAYVSDLGDHRALEQLR
RILRLLTSLKVVSVLPAPGRDPTPLSFWPFGRLRVLELRGCDLSTSAAKGLLELRHTLEKIVCHNSTDALRHVFASRIAE
IKHSPVWNRLSFVSCACNGLVLMDESLQLLPVVETLDLSRNKFAMVDNLRKCGKLKHLDLGFNHLRTIASIGEVTSRLIK
LVLRNNALSSLRGIENLKSLEALDVSYNIISNFSELEFLGGLPSLQSLWLEGNPLCCASWYRSQVFSYFSNPEKLKLDDK
EISTREFWKRQLIIASRQKRPASFGFYSPAKCDDKGDASINRRRKKVSRLASIVSEEGSTSLCSDQESASCDNEIQSREE
LVISDDEAEIVDLMTRVELMKKERSVLWLREFKEWLDHAPEDSVDNNRHGGMTLHSGKENYIKEKASWMQLGVNSRFISD
YAHSSGDERSTNVLDSDSSFLDMSTGLHAHHFDQIGSLGNAGFAKDTLKDNSHEGTSNVPLQAKSFHGHIFTSQKGRRMV
ENLSMSLSSIDDISESRSSSVFPGSPPHYQKDILHRRHNLEEEILQLSAESFSVASSDSNTSCSEDDHCESRHSIPEGHQ
LLNKSVEENLSSDPFRLYDMRYEVPPVRGSDRSSVGIGAEKISNSDQSLQSHASVPGHTHDGEIAHFVDEEGDLERTKHR
QKIKRRVVTLLEDEIMVRQVETLPTINGSMENHITKLEDEQESRSFYGVNFDEVIGKNQMVANTSNIPLPNDNTGSSGAE
CCSSRSDEFIEDYFKKSVADMGNNEICKQYIRCYCILEQDSLYREREVAVLLSSENKVYVLLIGTGGDGSGTILNLQGSH
SVEDIREVVVSLGLQVVRLVNKVQVRLFEKQICGGSKLSIFQYSMVQFWCSNVEDLMQFSSLSVDTPLPPYFSLDLCCSI
ADISELVVETRESRFLTIAVECAMSEFSTPKAGKEDPGENDINTASGSMTWKLKWFSEESRFKFVALLKAIHAGLTLSPL
LIRCIS*

DNA
ATGGCGATTGTGACCGGAGATCGCTACCTGGAGAAGCTGGTCCAGTTTGTGGAGAAGCACGCCGGCTCTCTGATCGACGG
CTCGTTAGTGCTGAAGCTCAACCCAGCCGGCTTCCACTACGTCCACTCGCGCCTCGAGGCCTTGCACGAGCTCGAGAGCC
TCCTCGCCGGCGCTCCGGTAGATTATCTCCGAGCCTATGTTTCCGACCTCGGCGACCACCGCGCGCTCGAGCAGCTTCGG
AGGATTCTTAGGCTCCTTACCTCGCTTAAGGTCGTCTCGGTGCTGCCGGCTCCCGGTAGGGACCCCACGCCGCTGTCGTT
TTGGCCGTTCGGGAGGCTTAGGGTTTTGGAGCTTCGCGGATGCGATTTGTCCACGTCGGCGGCGAAAGGTCTGCTCGAGT
TGAGGCACACCTTGGAGAAGATCGTCTGTCACAATTCCACTGATGCTCTGCGGCATGTGTTTGCGAGTAGAATTGCAGAG
ATTAAGCACTCGCCGGTGTGGAACCGGTTGTCATTTGTTTCGTGTGCTTGTAATGGCCTGGTTCTGATGGATGAGTCTTT
GCAACTACTTCCCGTAGTGGAAACTCTTGACCTGAGCCGAAACAAGTTTGCAATGGTTGACAATCTTCGCAAGTGTGGCA
AATTAAAACACCTAGACCTTGGTTTCAATCATCTGAGAACGATTGCGTCAATCGGTGAGGTCACCTCTCGACTAATTAAA
CTTGTTTTGAGGAACAATGCTCTATCTTCATTGCGTGGGATTGAGAATTTGAAGTCACTTGAAGCGCTTGATGTTTCCTA
CAATATTATTTCCAATTTTTCAGAGTTAGAGTTCCTTGGTGGTCTTCCATCTCTACAAAGCTTGTGGTTGGAAGGGAATC
CATTATGTTGTGCCAGTTGGTATCGGTCACAAGTATTCAGCTATTTCTCTAATCCCGAAAAATTGAAGTTAGATGATAAG
GAAATCAGCACCAGAGAGTTCTGGAAGAGGCAACTAATTATTGCAAGTAGACAGAAGCGACCTGCAAGCTTTGGGTTTTA
TTCCCCTGCAAAGTGTGATGATAAAGGAGATGCAAGTATCAACAGAAGAAGGAAAAAGGTGTCACGTCTTGCTTCCATTG
TAAGTGAAGAAGGGAGCACATCTCTATGTTCTGATCAGGAGTCTGCGTCTTGTGACAATGAGATTCAAAGCAGAGAAGAA
CTTGTTATATCTGATGATGAAGCTGAAATTGTTGATTTGATGACTAGAGTAGAGCTAATGAAAAAGGAGCGCTCTGTTCT
TTGGTTGCGGGAGTTCAAAGAATGGTTGGATCATGCTCCTGAGGATTCTGTGGACAACAATAGGCATGGTGGGATGACAC
TGCATAGTGGCAAGGAAAATTATATAAAAGAAAAGGCAAGCTGGATGCAGCTTGGTGTCAACTCCAGATTTATTTCAGAT
TACGCACATTCCTCAGGAGATGAGAGAAGTACAAATGTTTTAGATTCAGATAGTTCTTTCTTGGATATGTCCACTGGTCT
GCATGCCCATCACTTTGATCAAATTGGTTCCTTGGGGAATGCTGGTTTCGCCAAGGATACCCTAAAAGACAATTCACATG
AAGGAACGAGTAATGTCCCTTTACAAGCAAAAAGTTTCCATGGTCACATATTCACCAGTCAAAAAGGTCGTAGGATGGTG
GAAAATTTGAGTATGTCGTTGAGTTCTATAGATGATATTTCTGAATCTCGCTCATCGTCTGTGTTCCCGGGATCGCCACC
TCATTATCAAAAGGACATTCTTCATCGTCGTCATAACTTAGAGGAAGAAATTTTACAGTTGTCTGCAGAGTCATTTTCAG
TGGCATCTTCTGATAGTAATACGAGCTGCAGTGAAGATGACCACTGTGAGTCTAGGCACTCCATTCCTGAAGGTCATCAG
CTACTAAATAAGAGTGTGGAAGAAAATCTGTCTTCAGATCCTTTTAGGTTGTATGACATGAGATATGAGGTTCCACCTGT
AAGAGGAAGTGACAGGAGTTCAGTTGGAATAGGTGCAGAGAAAATTTCAAACTCAGACCAGTCGCTGCAATCACATGCCA
GTGTTCCAGGTCACACTCATGATGGTGAGATTGCTCATTTTGTTGATGAAGAAGGTGATTTAGAGAGGACAAAACACAGA
CAGAAAATAAAAAGAAGAGTTGTTACTCTACTAGAAGACGAAATTATGGTTAGGCAAGTAGAAACATTACCAACAATAAA
TGGTAGTATGGAAAATCATATAACGAAACTGGAAGATGAGCAAGAGAGTCGATCTTTTTATGGGGTTAACTTTGATGAAG
TTATTGGTAAGAACCAGATGGTGGCAAATACAAGTAATATCCCACTTCCAAATGATAATACTGGATCTTCTGGGGCAGAG
TGTTGCTCTTCAAGGAGTGATGAATTTATTGAGGACTATTTCAAAAAGAGTGTTGCAGACATGGGAAATAATGAAATTTG
CAAGCAGTACATACGCTGCTATTGTATACTTGAGCAGGATTCCTTATATAGAGAAAGAGAAGTAGCTGTCTTGCTGAGCA
GTGAAAACAAAGTGTATGTGCTACTAATTGGTACTGGAGGTGATGGATCAGGCACTATCTTGAATTTGCAGGGTTCTCAT
AGTGTTGAAGACATAAGAGAAGTGGTAGTTAGCTTAGGACTTCAGGTTGTGAGGTTAGTGAATAAGGTTCAGGTCAGATT
GTTTGAGAAACAAATATGTGGAGGTTCTAAACTGAGCATATTCCAGTATTCTATGGTGCAGTTTTGGTGTAGTAATGTTG
AAGACCTCATGCAGTTTAGCTCTTTATCAGTGGATACGCCTCTACCTCCATATTTTTCACTCGACTTGTGTTGCTCCATT
GCTGACATATCTGAGCTGGTTGTCGAGACCAGGGAAAGTCGGTTTTTAACCATAGCTGTTGAGTGTGCAATGTCGGAATT
CTCCACACCCAAGGCTGGGAAAGAAGACCCAGGTGAAAATGACATAAACACAGCTTCAGGCTCTATGACCTGGAAACTCA
AGTGGTTTTCTGAAGAGAGTCGGTTCAAGTTTGTGGCATTGTTGAAGGCAATCCATGCTGGGTTGACTCTTTCTCCTTTG
TTGATAAGATGTATATCATGA