Details for Strawberry Locus mrna09362

Position : LG5 ( 5`- 9941808 .. 9943775 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09362

Protein [Map View]
MATTTTTTSIAKTITKLYTCNRGSLSSTPSQLGSFQSSSLSSSSTAAASSEPEFQSAISSQAPERERSRWSKWLLFLPGA
ITFGLGTWQIVRRQDKIQMLEYRRKRLEMEPLQFNHVSPSTKELENLEFRRVLCKGHFDEKGSIYVGPRSRSISGVTENG
YYVITPLLPVSDEAESSQPPILVNRGWVPRSWKEKSSELPQDDEQPSNTTPSIGKEEERASWWRFWTKKPKVVEDQPPTQ
APDEVVGVIRGSEKPSIFVPPNDPNSGQWFYVDVPAIARTFGLPEDTIYIEDIHEDVNPSNPYPLPKDGSTLIRSSVMPQ
DHLNYTLTW*

DNA
ATGGCAACAACAACAACAACAACCTCCATTGCCAAAACCATAACCAAACTCTACACTTGTAACAGAGGCTCTCTCTCTTC
CACTCCCAGTCAATTGGGTTCATTTCAGTCTTCTTCATTGTCAAGCTCCTCTACTGCTGCAGCTTCCTCAGAACCTGAGT
TTCAATCAGCAATCTCTTCCCAAGCTCCAGAGAGGGAAAGGTCCAGATGGTCGAAATGGCTGCTGTTTCTTCCTGGAGCT
ATTACCTTTGGCCTTGGAACTTGGCAGATTGTCAGAAGGCAAGACAAGATACAAATGCTGGAGTATAGACGGAAAAGGCT
GGAGATGGAACCACTGCAATTTAACCATGTTTCTCCATCAACCAAAGAATTGGAGAATTTGGAGTTTAGGAGGGTGTTAT
GCAAAGGACATTTTGATGAGAAAGGTTCGATCTATGTGGGCCCTCGTTCAAGAAGCATTTCAGGAGTGACTGAAAATGGC
TACTATGTCATTACACCCCTTTTGCCAGTTTCTGACGAAGCTGAGAGTTCACAGCCGCCAATATTGGTCAATAGAGGATG
GGTCCCCCGCAGTTGGAAAGAAAAGTCTTCAGAACTTCCACAAGATGATGAACAACCTTCTAACACAACACCCAGTATTG
GCAAAGAGGAGGAAAGAGCATCTTGGTGGAGGTTCTGGACAAAGAAGCCTAAAGTTGTTGAGGATCAACCCCCTACACAA
GCTCCTGATGAAGTTGTTGGAGTAATTCGAGGGAGTGAAAAGCCTAGCATTTTTGTTCCACCAAATGATCCAAACTCTGG
TCAATGGTTCTATGTTGATGTTCCTGCAATTGCTCGTACATTTGGACTTCCTGAGGATACTATTTACATTGAGGACATAC
ATGAAGATGTCAATCCTAGTAATCCGTATCCACTTCCAAAAGATGGCAGTACCTTGATTCGGAGTTCAGTCATGCCTCAG
GACCATCTGAATTATACTTTGACATGGTAA