Details for Strawberry Locus mrna09357

Position : LG5 ( 5`- 9927738 .. 9930431 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09357

Protein [Map View]
MFSGVFCTYGFGRDVHVHCSVFMGEAIVILKGETVKSVVDTCVRTESDSRSNLYKLESAFEQGKSSSRVTEKNMDAAKVA
ELNEFITKLKSNPSILHNPSLAFFKSYLQSLGARIPVDPKMETKEEFDDDIVESDIELDDADVVEPDNDSPQQMGDPSVE
VTEEMQDAAQLAKLRAMDAVAEGKLDEAIDHITEAIMLNPTSAILKASRASIFVKLNKPNAAIRDANAAIEINPDSAKGY
KIRGTAKAMLGHWEEAASDLRIASKLDYDEEIGSVLKKVEPNARKIEEHRKKYQRLQKEREMKMAERERKRQAEARERDA
LSALKDGQVIAIHAASELETKLNAASKTSRLAILYFTATWCGPCRMISPIYTSLAEKYPKVVFTKIDIDAARDVAASWNI
SSVPAFFFVRNGKEIDKVVGADKAALEKKVAQYAGSA*

DNA
ATGTTCTCCGGAGTGTTTTGTACTTATGGGTTTGGACGTGATGTCCACGTCCACTGCAGTGTATTCATGGGTGAAGCCAT
AGTAATTTTGAAGGGTGAAACTGTAAAAAGTGTTGTTGATACTTGCGTCCGTACTGAATCCGATTCCAGAAGCAACTTGT
ACAAACTTGAAAGCGCTTTCGAACAAGGCAAAAGCAGTTCCAGAGTGACAGAGAAGAATATGGACGCTGCCAAAGTAGCC
GAACTGAACGAGTTCATCACTAAACTCAAGTCAAACCCGTCAATCCTTCACAACCCTTCTCTTGCTTTCTTCAAGTCCTA
TCTCCAAAGCTTAGGTGCTCGAATTCCAGTAGACCCAAAAATGGAAACTAAAGAAGAGTTTGATGATGACATTGTTGAGT
CCGATATTGAGTTGGATGATGCTGATGTTGTGGAGCCTGATAATGATTCTCCACAACAGATGGGAGATCCATCTGTTGAA
GTTACAGAAGAAATGCAGGATGCTGCGCAGTTAGCGAAATTGAGAGCTATGGATGCTGTTGCTGAAGGTAAGCTGGATGA
GGCCATAGATCATATAACAGAAGCCATCATGTTGAATCCAACTTCAGCCATACTAAAAGCATCCAGAGCTAGTATCTTTG
TCAAATTGAACAAACCAAATGCGGCAATTCGTGATGCTAATGCAGCTATAGAGATCAACCCAGACTCAGCAAAAGGATAT
AAAATAAGAGGAACCGCAAAGGCTATGTTGGGCCACTGGGAAGAAGCAGCAAGTGACCTGCGTATAGCATCCAAACTAGA
TTATGATGAGGAGATTGGTTCAGTGCTTAAAAAGGTTGAACCTAATGCCAGAAAAATTGAAGAGCATCGCAAAAAGTATC
AACGGTTGCAGAAAGAAAGGGAGATGAAAATGGCTGAACGTGAGAGAAAGAGGCAAGCTGAAGCTCGAGAACGGGATGCG
TTGTCTGCCCTGAAGGATGGGCAAGTCATTGCTATACACGCAGCCAGTGAACTTGAGACAAAGCTGAATGCTGCCTCAAA
GACATCGCGTCTTGCAATCCTCTACTTCACGGCGACATGGTGTGGTCCTTGCCGTATGATATCTCCAATATATACAAGCT
TAGCTGAAAAGTATCCAAAAGTAGTTTTCACGAAAATTGACATAGATGCAGCAAGAGATGTAGCTGCAAGCTGGAATATC
AGCAGTGTTCCGGCCTTTTTCTTTGTAAGAAATGGTAAGGAGATTGACAAGGTTGTGGGTGCTGATAAAGCTGCGCTAGA
AAAGAAGGTTGCACAATATGCAGGCTCAGCATAA