Details for Strawberry Locus mrna09356

Position : LG5 ( 5`- 9923238 .. 9926680 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09356

Protein [Map View]
MERDFLGLSSKQSYETVKEEASDEPKSSVVPRSSNSGMQWSFSNKVSAPPQFLSFTAPQEEMPREGVHDTSSFMTISTAD
AFDSSQKSFSSAIQRNFIHEKQAGNHYGMKVYSMQHRGANQIIPISLSTPALQHNFFGPKSMAGSSVKPQPLAGVPILTP
LSAVPSKSSVVGTTDLRNASNSSGVPAQLTIFYAGAVNVYHDISPEKAQAIMLLAGHGSSPAYNKQPSTAQLQTPFPSPS
TGDGFFGNQSIAGLASHSVTSHATARPGGEFSSSNSLAVSKPVATSVSSINQSEPSNVVAQSVMTNLIPAVPVPQARKAS
LARFFEKRKERMTSTLPYNLSKKSPDCSTPGSKGLSLSLNLSGSCPPQATN*

DNA
ATGGAGAGGGATTTCTTGGGTTTGAGTTCAAAGCAGAGCTATGAGACTGTGAAGGAGGAAGCCAGTGATGAACCCAAAAG
TTCAGTGGTACCAAGAAGCTCAAATTCAGGTATGCAGTGGTCATTTTCAAACAAGGTTTCTGCACCTCCTCAGTTCCTAT
CTTTCACAGCTCCTCAAGAAGAAATGCCAAGAGAAGGCGTTCATGACACTTCTTCATTCATGACTATATCAACTGCTGAT
GCTTTTGATTCTAGCCAGAAATCGTTCTCCAGTGCAATCCAGAGAAATTTCATTCATGAGAAGCAAGCTGGAAACCACTA
TGGAATGAAAGTCTATTCTATGCAACATCGAGGAGCCAATCAAATAATTCCTATTTCTTTGAGCACCCCTGCTCTCCAAC
ACAATTTTTTTGGGCCAAAAAGCATGGCTGGTTCATCAGTCAAACCACAGCCGCTTGCAGGAGTTCCAATTCTAACCCCT
CTATCTGCTGTTCCGTCTAAAAGTTCCGTAGTTGGTACCACTGATCTCAGGAATGCATCCAATTCTTCAGGAGTGCCTGC
TCAGTTAACAATTTTCTATGCTGGTGCTGTGAATGTATACCATGATATATCTCCTGAGAAGGCCCAGGCTATTATGTTGC
TGGCTGGACATGGATCGTCTCCAGCTTATAATAAGCAACCCTCCACAGCTCAATTGCAAACACCATTCCCTAGTCCTTCC
ACAGGTGATGGTTTCTTTGGGAACCAGTCAATCGCTGGCCTTGCAAGCCATTCTGTGACGTCACATGCTACTGCTCGCCC
TGGAGGAGAATTTAGTAGCAGCAACTCATTAGCGGTATCAAAACCAGTAGCAACTTCAGTATCTTCAATCAATCAGTCAG
AGCCTTCAAATGTAGTAGCACAATCTGTTATGACAAACCTCATTCCAGCAGTACCTGTGCCTCAAGCTCGTAAAGCATCC
TTGGCTCGATTTTTTGAAAAGCGCAAGGAGAGGATGACGAGCACATTGCCATACAATCTCAGCAAAAAATCTCCAGACTG
CAGCACACCAGGTTCCAAGGGCTTGAGTTTGTCTCTCAACTTGTCTGGTTCCTGTCCTCCCCAAGCTACGAATTAG