Details for Strawberry Locus mrna09353

Position : LG5 ( 5`- 9897515 .. 9902314 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09353

Protein [Map View]
MPIIQTHSPYSFSSSTLTPSSTFFIGKNPTLKLNFAPFIRTKPQRLVLKAAGTDYYKTLNLDRNANLKDIKTSYRKLARQ
YHPDMNKGSGAEDKFKEISAAYEVLSDEEKRATYDRFGEAGLQGEYGSSNMGSAGVDPFDVFDAFFGGRGGSGGMNFNVN
INTPNTGNQSLDIWYELHLSFEESIFGGQREFELSCIETCDTCSGTGAKSDDCIKSCTACGGRGGVTKTQRTPFGMISMV
STCSKCDGQGTIITDSCKKCIGKGQVKSKRAMVVTIPAGVSDGDTMKVQGEGNVDKRRGVVGDVYIMLRINEKAGIRRDG
LNLYSTINIDYTEAILGTVIKVETVEGMKELKIPSGIQPGETVKLSRMGVPNMRKPSVRGDHHFVVNVLIPKRISGTERT
LVEELASLKTSKKGHSGASKGIGTQDGNSDMHSSRNHETSTLSQGKRRVSSLWNSIKGVLGGRQSHDRFASVSVDRPALL
RGSSQPYSFYMASIFGVIVAASAFFFFIFSVFSISAAAVAMVNVPKTKKTYCKSKECKKHTLHKVTQYKKGKDSLAAQGK
RRYDRKQSGYGGQTKPVFHKKAKTTKKIVLRLQCQGCKHVSQHPIKRCKHFEIGGDKKGKGTSLF*

DNA
ATGCCCATCATCCAAACCCACTCACCTTACTCTTTTAGCTCCTCCACTCTCACACCCAGTTCCACATTCTTCATCGGAAA
AAACCCAACTCTGAAACTCAATTTCGCTCCTTTCATCCGTACAAAACCTCAACGTTTGGTCCTCAAGGCCGCCGGAACCG
ATTACTACAAGACCCTCAACCTCGACAGAAATGCAAACCTGAAGGATATAAAGACCTCTTATCGAAAGCTCGCTCGGCAG
TACCATCCTGATATGAACAAGGGCTCTGGAGCTGAAGACAAGTTCAAAGAGATTAGTGCTGCATATGAGGTCCTTTCAGA
TGAGGAGAAAAGAGCTACATATGACCGCTTTGGTGAGGCAGGCTTACAGGGAGAATATGGTTCCTCGAACATGGGTTCAG
CCGGGGTCGATCCTTTTGACGTTTTTGATGCATTCTTTGGAGGAAGAGGTGGATCAGGAGGCATGAACTTCAATGTTAAC
ATCAATACACCAAACACAGGAAATCAGAGCCTTGACATTTGGTATGAACTGCACCTTAGCTTTGAAGAATCCATTTTCGG
AGGACAGAGGGAGTTTGAACTTTCTTGTATTGAGACATGTGATACTTGTAGTGGAACTGGTGCTAAATCTGATGATTGCA
TCAAATCATGTACTGCTTGCGGAGGAAGAGGAGGGGTGACAAAAACTCAGAGAACACCATTTGGCATGATATCGATGGTA
TCTACCTGCTCAAAGTGTGACGGTCAAGGTACAATAATAACTGATTCTTGCAAAAAATGCATTGGCAAGGGACAAGTAAA
GTCAAAAAGAGCAATGGTTGTAACCATTCCAGCTGGTGTTAGTGATGGAGACACAATGAAAGTTCAAGGCGAGGGGAATG
TTGATAAGAGAAGGGGTGTAGTTGGTGATGTCTACATAATGCTTCGTATAAACGAAAAGGCTGGAATTCGGAGGGATGGT
CTCAATCTATATTCAACTATAAATATTGATTATACCGAGGCAATTTTAGGGACTGTGATAAAGGTAGAAACTGTGGAAGG
CATGAAAGAGCTTAAAATTCCATCTGGAATTCAGCCTGGGGAAACAGTAAAGTTGTCCCGTATGGGGGTTCCCAACATGC
GCAAGCCTTCTGTTAGAGGAGATCATCACTTTGTTGTGAATGTACTTATCCCAAAGAGAATCAGTGGCACAGAACGCACC
CTTGTTGAAGAATTGGCTTCACTTAAGACCTCTAAGAAGGGCCACTCAGGTGCTTCAAAAGGCATTGGGACACAAGATGG
GAACTCTGACATGCATAGTAGCAGAAACCATGAAACCAGTACTTTGAGCCAGGGCAAAAGACGTGTTTCATCCTTGTGGA
ACTCAATAAAAGGCGTATTGGGGGGGAGGCAGTCGCATGACAGATTTGCATCGGTTAGCGTGGACAGACCAGCACTTCTG
AGGGGTTCAAGCCAGCCTTATTCCTTTTATATGGCTTCGATTTTTGGAGTCATTGTTGCCGCTTCTGCTTTCTTCTTCTT
CATCTTCTCAGTCTTCTCCATATCCGCCGCCGCAGTAGCCATGGTGAACGTTCCGAAGACAAAGAAGACCTACTGCAAGA
GCAAGGAGTGCAAGAAGCACACCCTGCACAAAGTCACGCAGTACAAGAAGGGCAAGGACAGCCTTGCTGCCCAGGGGAAG
CGTCGTTATGATCGTAAGCAATCAGGTTATGGAGGTCAGACCAAGCCTGTGTTTCACAAGAAGGCCAAGACCACCAAGAA
GATTGTGTTGAGGCTCCAATGCCAGGGTTGCAAGCATGTGTCGCAGCACCCAATCAAGAGGTGCAAGCACTTTGAGATTG
GTGGAGACAAGAAGGGCAAGGGAACCTCTCTTTTCTAG