Details for Strawberry Locus mrna09349

Position : LG5 ( 5`- 9880310 .. 9881310 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09349

Protein [Map View]
MQLENMVSLVSRTGRHLQRYDKGCRQVVGCIPYRYRQTEQESSSVEDIEVLVISSQKGQGILFPKGGWELDESIEEAACR
ETLEEAGVTGHLELPILGKWPYKSKSQGTFHEGYMFPLLVNKQLESWPEKTVRKREWMTIADAKEACQNWWMREALDEFF
RRQTQTQEKEAQNVPVCT*

DNA
ATGCAATTGGAGAACATGGTCTCCTTGGTTTCCCGGACGGGAAGACATTTGCAGCGCTACGATAAAGGCTGCCGTCAAGT
TGTAGGATGCATACCCTACAGATATAGGCAAACAGAACAAGAGTCTTCGTCTGTGGAGGATATAGAAGTTCTTGTGATTA
GTTCACAAAAGGGTCAAGGAATTTTGTTCCCAAAGGGAGGTTGGGAACTTGATGAGTCAATTGAAGAAGCGGCTTGCAGA
GAAACGCTAGAGGAGGCCGGTGTGACTGGTCATCTTGAGCTGCCAATATTGGGCAAATGGCCTTACAAGAGTAAAAGCCA
GGGCACTTTTCATGAGGGGTACATGTTCCCTTTGCTTGTCAACAAGCAGTTAGAGTCTTGGCCTGAGAAGACCGTCAGAA
AACGAGAATGGATGACTATTGCTGACGCTAAAGAAGCATGCCAAAATTGGTGGATGAGGGAAGCTTTGGATGAATTTTTT
CGTCGACAAACGCAGACCCAAGAGAAAGAAGCACAAAATGTGCCTGTTTGTACATGA