Details for Strawberry Locus mrna09343

Position : LG5 ( 5`- 9834270 .. 9837130 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09343

Protein [Map View]
MASLSLTQIRGNSINNPVAEFARTRCPQLGLPVRSSRVGFRVFASESSSKGPEPDLSVNVNGLHMPNPFVIGSGPPGTNY
TVMKRAFDEGWGAVIAKTVSLDAEKVKNVTPRYAKLRADANGSKQGQIIGWQNIELISDRPLETMLKEFKQLKEEYPDRI
LIASIMEEYNKAGWEELIDRVEQTGVDAFEINFSCPHGMPERKMGAAVGQDCALLEDVCGWINAKATIPVWAKMTPNVTD
ITQPARVALNSGCEGIAAINTIMSVMGINLTTLRPEPCVEGYSTPGGYSSKAVHPIALAKVMSIAKMMRSEFGDKDLSLS
GIGGVESGGDAAEFILLGANSVQVCTGVMMHGYGVVKKLCSELKDFMRQHNFSSIEDFRGASLEYFTTHTDLVHRQQEAI
QQRKAVKRGLQSDKDWTGDGFVKETESMVSN*

DNA
ATGGCGTCGCTTAGCTTGACTCAGATCAGAGGCAACAGCATCAACAACCCAGTTGCCGAGTTTGCCAGAACTCGTTGTCC
TCAGTTGGGTTTGCCAGTTCGGTCTAGCAGAGTTGGGTTTCGGGTGTTTGCGTCAGAGAGCAGCAGCAAGGGCCCAGAGC
CTGATCTGAGCGTCAATGTAAATGGGTTACACATGCCTAACCCCTTTGTTATTGGGTCGGGTCCACCCGGTACCAACTAC
ACCGTCATGAAAAGGGCCTTTGATGAAGGCTGGGGTGCTGTGATTGCCAAAACTGTGTCGCTAGATGCAGAAAAAGTCAA
GAATGTCACTCCACGATATGCAAAGCTACGTGCCGATGCAAATGGCTCAAAACAAGGGCAGATTATTGGGTGGCAGAATA
TAGAACTTATAAGTGACAGACCTCTAGAAACCATGTTGAAAGAATTCAAGCAATTGAAGGAAGAGTATCCAGACAGGATT
TTGATTGCTTCAATCATGGAGGAATATAACAAAGCTGGCTGGGAGGAACTTATTGATCGTGTGGAGCAAACTGGAGTTGA
TGCCTTTGAAATCAACTTCTCCTGTCCTCATGGTATGCCGGAGCGCAAGATGGGTGCTGCTGTTGGACAAGACTGTGCAT
TGTTGGAAGATGTCTGTGGATGGATAAATGCCAAAGCTACAATACCGGTTTGGGCAAAGATGACTCCTAACGTCACTGAC
ATTACACAGCCAGCTAGAGTGGCTCTGAACTCAGGATGTGAGGGAATAGCAGCTATTAACACAATCATGAGTGTAATGGG
AATCAATCTGACTACCTTACGGCCTGAGCCTTGTGTGGAGGGATACTCAACTCCCGGAGGCTATTCTTCCAAGGCAGTTC
ATCCCATTGCACTTGCAAAAGTGATGAGTATTGCAAAAATGATGAGATCAGAATTTGGTGATAAAGATCTTTCACTTTCT
GGGATCGGGGGTGTTGAGTCCGGTGGTGATGCTGCTGAGTTTATCCTTCTGGGAGCAAATTCTGTACAGGTCTGTACTGG
GGTCATGATGCATGGATACGGTGTTGTGAAGAAACTCTGTTCTGAGCTAAAGGACTTTATGAGACAGCACAATTTCTCAT
CTATAGAAGATTTCAGAGGGGCTTCCCTCGAGTATTTTACAACGCATACTGATTTAGTACACAGACAGCAAGAAGCCATC
CAACAAAGAAAAGCCGTGAAGAGAGGGTTGCAGTCCGACAAAGATTGGACAGGAGATGGTTTCGTTAAAGAAACCGAGAG
CATGGTCTCTAATTAA