Details for Strawberry Locus mrna09341

Position : LG5 ( 5`- 9821032 .. 9825642 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09341

Protein [Map View]
MALIRERRQLNLSLPLPEPTERRPRFTLPLPPAAVVAAANCSSSSSSSAAVSASDLERLEVLGHGSGGTVYKVRHKRTGA
NYALKIVKGDSDPTVRRQLYREIEILRRTDSPHVVHCDAIIEKPTGDMWILMEYMDSGTLESLLKQQGTFSEAKLVHVAR
QVLNGLNYLHGQKIIHRDIKPANLLVNSNMEVKVADFGVSKMLCRTLDNCNSYVGTCAYMSPERFDPDTYGGNYNGYASD
IWSLGLTLMELYMGHFPFLPPGQRPDWATLMCAICFGEPPALPEGVSEEFRSFMECCLQKESGKRWTAAQLLTHPFVCAD
FPSFATVRRRRGRASTPADSNSFPDHFLSPASPPNSSFQARSPKTSNKVNLAGKLEFGGLAGDGKWSGKLLEFVGLRCAL
ADAVQ*

DNA
ATGGCTCTCATCCGGGAACGCCGCCAGCTCAACCTCAGCCTCCCCTTGCCGGAGCCCACCGAGCGTCGCCCACGTTTCAC
TCTCCCTCTCCCTCCCGCCGCCGTAGTCGCCGCCGCCAACTGCTCCTCCTCGTCTTCCTCTTCCGCCGCGGTATCCGCCT
CCGACCTCGAAAGACTCGAGGTCCTCGGCCACGGTAGCGGCGGCACAGTCTACAAAGTCCGCCACAAGCGCACGGGAGCT
AACTACGCCCTGAAAATAGTGAAAGGCGACTCCGACCCCACCGTCCGCCGCCAACTCTACCGCGAGATCGAAATCCTCCG
CCGCACGGACTCCCCCCACGTCGTCCACTGCGACGCCATAATCGAGAAGCCGACCGGAGACATGTGGATTCTCATGGAGT
ACATGGACTCGGGAACGTTAGAGAGTTTGCTCAAACAGCAAGGCACGTTCTCCGAGGCCAAGCTCGTTCACGTTGCACGT
CAAGTCCTCAACGGGCTCAACTACCTCCACGGTCAGAAGATCATCCACCGTGACATCAAGCCGGCCAATCTGTTAGTCAA
CAGCAACATGGAGGTCAAGGTCGCCGACTTCGGCGTCAGCAAAATGTTGTGCCGAACACTCGACAACTGCAACTCGTACG
TTGGGACTTGCGCTTACATGAGCCCCGAGAGGTTCGACCCCGACACGTACGGTGGAAACTACAACGGCTACGCTAGTGAT
ATATGGAGCTTGGGTTTGACTCTCATGGAGCTTTACATGGGTCACTTCCCGTTCTTGCCTCCGGGTCAAAGACCCGACTG
GGCGACCCTTATGTGCGCCATATGCTTCGGGGAGCCACCGGCGCTGCCGGAGGGAGTGTCGGAGGAGTTTAGGAGTTTTA
TGGAGTGTTGCTTGCAGAAGGAGTCGGGGAAGAGGTGGACGGCGGCTCAGCTTTTGACCCACCCGTTCGTTTGTGCAGAT
TTCCCTTCGTTCGCCACCGTACGACGCCGGCGAGGGCGCGCCTCCACCCCAGCGGACTCAAACAGCTTCCCCGACCACTT
TCTCTCCCCGGCGAGTCCGCCAAATTCCAGTTTTCAGGCCAGATCACCCAAAACTTCAAATAAAGTAAATCTAGCCGGAA
AACTGGAATTCGGCGGACTCGCCGGGGATGGAAAGTGGTCGGGGAAGCTGCTGGAGTTCGTTGGGTTGAGGTGCGCCCTA
GCCGATGCCGTACAGTGA