Details for Strawberry Locus mrna09334

Position : LG5 ( 5`- 9791104 .. 9792567 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09334

Protein [Map View]
MEAAATASFVHSSVAAFRPSNSVGRSPLLMGPKFLPLGPLGAKSHSSIKQHQLGFGRRRCLVVRAASSSSDSGGSSAPIA
PLQLESPIGQFLSQMMISHPHLVPTAVEQQLEQLQTARDAEEKKEKEEASASGTDLVLYRRIAEVKANERKKALEEILYA
LVVQKFMDANVSLVPSIAPAASDPSGRVDAWPSQDDKLERLHSPEAYEMIQNHLSLILGNRLDDSTSLAQISKLKVGQVY
AASVMYGYFLKRVDQRFQLEKTMKILPGSLGGEDSDIEKAVGEDKRLGGVDNSASHPEVSSWSGGLGSGGFGNLIKPSRL
RTYVMSVDGETLQRYATIRSREAVSIIEKHTEALFGRPDIVITPQGTVDSSNDEHIKISFGGLKRLVLEAVTFGSFLWDV
ESYVDSRYHFVTN*

DNA
ATGGAAGCAGCAGCCACGGCGAGCTTTGTCCACTCATCAGTCGCGGCCTTCAGGCCTTCCAATTCAGTCGGAAGGTCGCC
TCTTCTGATGGGCCCCAAGTTTCTGCCTTTGGGACCTTTGGGTGCCAAATCTCACTCCTCCATCAAGCAGCATCAATTGG
GTTTTGGAAGGAGGAGGTGCTTGGTTGTTAGGGCGGCGTCTTCGTCTTCAGACTCTGGTGGTTCTAGTGCTCCAATTGCT
CCACTTCAGCTGGAGTCTCCGATTGGTCAGTTTTTATCTCAGATGATGATAAGCCACCCGCATCTTGTGCCTACTGCTGT
CGAGCAGCAGCTGGAACAGCTCCAGACGGCCCGCGATGCTGAGGAAAAGAAGGAGAAGGAAGAGGCTTCCGCGTCGGGCA
CTGATCTTGTTTTATATAGGAGAATTGCCGAGGTTAAAGCTAATGAAAGGAAGAAGGCTCTCGAAGAGATATTATATGCG
TTGGTGGTGCAGAAATTCATGGATGCTAATGTTTCTTTGGTACCCTCTATTGCCCCGGCTGCTTCAGACCCTTCTGGCCG
AGTTGATGCATGGCCGAGTCAGGATGACAAGCTTGAGCGACTGCATTCTCCTGAAGCCTACGAGATGATTCAGAATCACC
TGTCTCTGATCCTAGGGAATCGGTTGGACGACTCGACCTCTTTAGCGCAGATAAGCAAGCTCAAAGTGGGGCAGGTTTAT
GCGGCATCTGTAATGTATGGATACTTCCTCAAGCGGGTTGATCAGAGGTTTCAGCTTGAGAAGACAATGAAGATCCTTCC
AGGTTCACTGGGCGGAGAAGACAGTGATATTGAAAAGGCAGTGGGTGAGGACAAGAGGCTTGGTGGTGTGGATAATTCAG
CTTCCCATCCTGAAGTGTCTTCTTGGTCTGGGGGCTTGGGTTCTGGAGGTTTTGGTAACTTGATCAAACCATCTCGCTTG
AGAACCTATGTTATGTCTGTTGATGGAGAGACCCTCCAAAGATATGCAACAATCAGATCAAGAGAGGCTGTTAGCATCAT
TGAAAAGCATACCGAGGCATTGTTTGGGAGACCTGATATTGTTATAACTCCTCAGGGGACAGTTGATTCTTCCAACGATG
AACACATCAAAATCAGCTTTGGTGGTTTGAAGAGACTTGTTCTGGAAGCTGTGACTTTCGGTTCTTTCCTCTGGGATGTT
GAGAGCTATGTGGATTCCAGGTACCATTTTGTTACAAACTGA