Details for Strawberry Locus mrna09333

Position : LG5 ( 5`- 9787979 .. 9789618 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09333

Protein [Map View]
MALNIPSKKSRTLCFFLVLIICIVTTLAELQRFEHPTKEDGSLSFLVLGDWGRRGDFNQSEVAFQMGRVGEKFDIDFVVS
TGDNFYDNGLSSEHDTAFEESFTNIYTQTSLQKQWYSILGNHDYRGDAEAQLSPQLRKIDRRWLCLRSFIVDAELAEILF
VDTTPFVDMYFTSTEDHTYDWRGIPSRKAYIQTLLKDVELALKKSSAKWKIVVGHHAIRSIGHHGDTQELINHLLPILQA
NDVDFYMNGHDHCLEHISDNKRCGIQFLTSGAGSKAWRGDMKNEEALNKQGQLVNFFYDGQGFMSVQLNPTQAEIAFFDV
FGNVIHSWTAFKLLHPSI*

DNA
ATGGCCCTAAATATTCCTAGTAAGAAATCCAGGACCTTGTGCTTTTTCTTGGTCCTTATTATTTGTATTGTAACTACATT
AGCAGAGCTGCAGAGATTCGAACACCCCACAAAAGAAGATGGATCACTTAGTTTTCTGGTGCTTGGTGACTGGGGAAGAA
GAGGAGATTTTAACCAGTCAGAAGTTGCCTTTCAGATGGGAAGGGTTGGAGAGAAATTTGACATAGATTTTGTGGTTTCC
ACCGGAGACAACTTTTATGACAATGGGTTGAGCAGTGAACACGATACAGCATTTGAGGAGTCATTTACCAACATCTATAC
ACAAACGAGTCTGCAAAAGCAATGGTACAGCATTTTAGGCAACCATGATTATAGGGGTGATGCAGAGGCTCAGCTCAGCC
CCCAGCTAAGGAAGATTGACAGAAGATGGCTTTGCTTAAGGTCTTTCATTGTCGACGCAGAATTAGCAGAGATTTTGTTT
GTAGACACCACTCCTTTTGTCGATATGTACTTCACAAGCACAGAGGACCATACTTATGACTGGCGAGGAATTCCTTCTCG
CAAGGCTTATATTCAAACCCTGTTAAAGGATGTTGAGTTAGCACTGAAAAAGTCATCTGCAAAGTGGAAGATAGTTGTTG
GACACCATGCAATCAGAAGTATTGGGCATCATGGTGATACACAGGAGCTTATAAATCACCTTCTCCCAATTCTTCAGGCC
AATGATGTGGACTTCTACATGAATGGGCACGATCATTGCCTAGAACACATCAGTGACAACAAAAGGTGCGGAATACAGTT
TCTGACGAGTGGAGCAGGATCCAAAGCATGGAGAGGAGACATGAAGAATGAGGAGGCTTTGAACAAACAAGGCCAACTGG
TGAACTTCTTCTATGATGGTCAAGGCTTCATGTCTGTGCAGTTGAATCCCACTCAAGCAGAGATCGCTTTCTTTGATGTC
TTTGGCAACGTCATACATTCATGGACTGCTTTCAAGCTGCTTCACCCATCTATTTGA