Details for Strawberry Locus mrna09327

Position : LG5 ( 5`- 9748472 .. 9754422 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09327

Protein [Map View]
MAFQDKKLINNPNDVVTEFIEGLVETYPGLQYLDGFPQVKVVLRADVSGGSYDKVAVISGGGSGHEPAHAGFVGEGMLTA
AICGDVFASPPVDSILAGIRAVTGPMGCLLIVKNYTGDRLNFGLAAEQAKSEGYNVETVIVGDDCALPPPRGIAGRRGLA
GTILVHKVAGAAAASGSSLADVAAEARRASEMVGTMGVALSVCTLPGRVTPDRLGPGKMELGLGIHGEPGAAVADLQPVD
VIVSHVLKQILCPETNYVPITRGSRVVLMVNGLGATPAMELMITSGKAVPKLQLEHGLAVDRVYTGSFMTSLDMAGFSIS
IMKADQAILQRLDAPTKAPYWPVGVDGNHPPAKIPVPLPPSRSTKIDEPLGRPAQLNEQGRILEVAIEAAANAVQNLRDE
LNDWDSKVGDGDCGSTELSHAKSYVCCVRCIEVQQQFWKTCRTETVNEIGASVRRVMGGTSGILYTIFCKAAYAQLKTST
QSVVTSKNWAEALEASIAAVSKYGGASAGYRTLLDALIPASAVLRERLNAGDDPATAFAGRSSYVSGEILASVPDPGAMA
AASWYKAAALAVKEKYLAP*

DNA
ATGGCTTTCCAGGACAAGAAGCTCATCAACAACCCCAACGATGTGGTGACTGAGTTCATTGAAGGTCTGGTTGAGACTTA
CCCTGGGCTGCAGTACTTGGATGGTTTCCCTCAGGTGAAAGTTGTGTTGCGCGCTGATGTTTCCGGTGGTTCTTATGACA
AAGTTGCAGTTATATCAGGAGGTGGGAGTGGGCATGAACCCGCACATGCTGGATTTGTGGGGGAAGGGATGTTGACAGCA
GCTATCTGCGGGGATGTCTTTGCCTCTCCACCGGTTGATTCAATTCTAGCGGGCATCCGAGCTGTAACTGGTCCAATGGG
TTGTCTCCTGATTGTCAAGAATTATACTGGGGACCGTCTGAATTTCGGTTTGGCTGCAGAGCAAGCAAAATCGGAAGGTT
ACAACGTAGAGACTGTAATTGTTGGGGATGATTGTGCATTGCCCCCGCCTCGAGGAATAGCTGGTCGGAGGGGTTTGGCC
GGTACCATTCTTGTTCATAAGGTTGCTGGAGCTGCAGCTGCTTCTGGGAGTTCTCTTGCTGATGTTGCAGCAGAAGCAAG
ACGTGCATCAGAAATGGTTGGAACAATGGGTGTTGCATTATCTGTTTGCACACTGCCTGGTCGGGTCACACCAGACCGTT
TGGGACCTGGAAAGATGGAACTTGGTCTTGGAATTCATGGAGAACCGGGTGCTGCTGTTGCTGACCTTCAGCCTGTGGAT
GTTATAGTCTCTCATGTTCTCAAGCAGATATTGTGTCCGGAGACTAATTATGTTCCGATTACTCGTGGAAGTAGAGTGGT
GCTTATGGTCAATGGGTTAGGTGCAACTCCCGCAATGGAACTGATGATCACATCTGGTAAAGCAGTACCTAAGTTGCAGC
TGGAACATGGATTAGCTGTTGATAGAGTTTATACCGGATCATTCATGACCTCTCTTGATATGGCAGGTTTTTCGATATCT
ATCATGAAGGCTGATCAAGCTATTTTACAACGTCTGGATGCTCCAACAAAGGCTCCCTATTGGCCTGTTGGCGTAGATGG
CAATCACCCACCCGCAAAGATTCCTGTTCCATTGCCTCCTTCTCGTTCAACAAAGATCGATGAGCCATTAGGTCGACCAG
CACAACTGAATGAACAAGGCCGTATTCTTGAGGTGGCAATTGAAGCAGCTGCAAATGCAGTTCAGAACCTCAGGGATGAA
TTGAATGATTGGGATAGCAAAGTAGGTGATGGTGATTGCGGGTCAACAGAACTGTCACATGCTAAATCTTATGTTTGCTG
TGTCAGATGTATAGAGGTGCAACAGCAATTTTGGAAGACATGCAGAACGGAAACAGTGAACGAAATTGGTGCATCTGTTA
GAAGAGTTATGGGAGGCACAAGTGGGATCCTGTATACCATATTTTGTAAGGCAGCGTATGCACAGTTGAAAACAAGCACC
CAATCTGTTGTGACATCAAAAAATTGGGCTGAAGCACTTGAAGCTTCCATTGCTGCAGTCAGCAAATATGGTGGGGCTAG
TGCTGGGTATCGCACATTGTTAGACGCCCTTATTCCAGCATCAGCAGTTCTTCGAGAGAGGTTAAATGCTGGTGATGATC
CTGCAACTGCTTTTGCTGGGCGTTCGAGCTATGTCTCTGGAGAGATACTAGCATCAGTCCCAGACCCAGGTGCAATGGCT
GCAGCGTCATGGTACAAGGCAGCAGCCTTAGCTGTGAAGGAAAAATATCTGGCTCCATGA