Details for Strawberry Locus mrna09315

Position : LG5 ( 5`- 9670519 .. 9678019 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09315

Protein [Map View]
MQMPMSRASETKNNKEKKREKLWTTPKFEKDQAEKKPLFARSNRPLPFHHHQDFEGFLKVLIFWGFGNRNLAVNAGSALR
YCVVFYKLGLGNFEQKLNAFGYKRKKMAESNSVDVILDFLRKNRFSRAEAALRSELGNRPDLNGFLEKLTIEEKDSGNLL
EAEKGDKLVVDSQGLGSRNGGEELIVKEIECGTGRNGSEIKWKNAASVGERNKPVEVAGTNHKSFAFSKGLEDTVLDLYS
WKINPSNGPAEPYQNDGVAVKSNHPEPQILQQSRNHSVDIPDSGKSTLKSGEESSFSGEKKTSWPGSTSKTSVESKYDRT
QTSEPKELDQQLKNSTTYFKENFADNPWSRVEEPTSSSSETWKDCSVKTVFPFPKGDMSTSYDSASGSDKKEGKRKAQLT
DTRAAIKEQENEVARALYLGKSQGSSEQKTISSLVFPILSENQKEEFPRLPPVKLKSEDKPLTVNWEEKFERDGPGAKLS
AADNAHLIGAYLDVPFGQEISSSGPGGKRNVGGGSWLSVSQGIAEDTSDLVSGFATVGDGLSEDYPNEYWDSDEYDDDDD
VGYMRQPIEDEAWFLAHEIDYPSDNEKGAGHGSVPDPQERGPTKDEDDDQSFAEEDSYFSGERYFQGKNVEPVTDDPMGI
TVTELYGRTDENDLIAQYDGQLMDEEELNLMRAEPVWQGFVTQTNELIMLGDGKVMNELGRPRLDDVCVEDDQLGSVRSI
GVGINSDVAEMGSEVRESLVGGSSEGDLEYFRDHDEGIGGSRKPHHDSDKKHIDRSNRDKKKSSKHEANKYIVVADDDSA
SRPKKSHTEGAFSFPPPLRDGEQSVQASSSKSLWSNNCNIIVTDETDDCTNTLLSNDDMLASWKRKSTDTSPDENNDDAV
RSRNSTPSTLSNYAYAEREHGKQEEDEKIAALREEDTGVSLEDEEAAAVQEQVRQIKAQEEETGFEEDKNFHVVLNSVIA
GRYHVTEYLGSAAFSKAIQAHDLHTGMDVCVKIIKNNKDFFDQSLDEIKLLKYVNKHDPADKYHLLRLYDYFYYREHLLI
VCELLKANLYEFHKFNRESGGEVYFTMPRLQSITIQCLEALQFLHGLGLIHCDLKPENILVKSYSRCEVKVIDLGSSCFE
TDHLCSYVQSRSYRAPEVILGLPYDKKIDIWSLGCILAELCTGNVLFQNDSPATLLARVMGIICPIDQSMLAKGRDTYKY
FTKNHMLYERNQETNRLEYLIPKKTSLRHRLPMGDQGFIDFVAHLLEINPKKRPSAAEALKHPWLSYPYEPISS*

DNA
ATGCAAATGCCAATGTCAAGAGCATCTGAAACAAAAAATAATAAGGAAAAGAAAAGAGAGAAGCTTTGGACCACCCCCAA
ATTTGAGAAGGACCAGGCAGAGAAGAAGCCCCTTTTCGCAAGGAGCAACCGGCCACTCCCATTTCACCACCACCAGGATT
TTGAGGGTTTTCTGAAAGTTTTGATTTTTTGGGGATTCGGGAATCGCAATCTGGCTGTGAATGCCGGATCCGCGTTGAGG
TATTGTGTTGTGTTTTACAAGTTGGGGTTGGGAAATTTTGAGCAAAAGTTGAATGCTTTTGGCTATAAGAGGAAGAAAAT
GGCGGAGTCGAACTCGGTTGATGTCATTCTTGACTTTCTGCGGAAGAATAGGTTTTCAAGAGCTGAGGCAGCTCTTCGCA
GTGAGCTTGGTAATCGTCCTGATTTGAATGGTTTCCTTGAGAAGCTTACTATTGAAGAGAAGGACTCTGGTAATTTGTTG
GAAGCTGAAAAGGGGGACAAACTGGTGGTGGACAGTCAAGGGCTGGGATCACGGAACGGTGGTGAGGAACTTATAGTGAA
AGAGATAGAATGTGGAACTGGAAGAAATGGGTCTGAAATCAAATGGAAGAATGCTGCTTCTGTTGGGGAACGAAATAAAC
CGGTTGAGGTGGCTGGGACTAATCACAAGAGCTTCGCATTCTCCAAAGGTTTAGAGGATACTGTGCTTGATTTATATTCA
TGGAAGATCAATCCAAGCAATGGTCCTGCTGAACCTTATCAAAATGATGGTGTTGCTGTTAAGTCTAACCACCCAGAGCC
TCAGATATTGCAACAATCAAGGAATCATTCTGTGGACATTCCTGATTCTGGTAAAAGCACTCTGAAATCTGGAGAAGAGA
GTAGCTTTTCTGGTGAGAAGAAAACTTCATGGCCTGGAAGTACTAGCAAAACCAGTGTGGAAAGCAAGTACGATAGAACT
CAAACAAGTGAACCTAAGGAACTTGACCAACAACTTAAGAATAGTACCACGTACTTCAAAGAAAACTTTGCGGATAATCC
ATGGTCAAGAGTTGAAGAACCGACCAGTTCATCATCAGAGACGTGGAAAGATTGTTCTGTCAAGACTGTATTTCCTTTTC
CCAAAGGGGATATGTCAACAAGTTATGATAGTGCTTCTGGTTCTGATAAAAAAGAAGGAAAGAGAAAAGCGCAGCTGACT
GATACTAGGGCAGCAATAAAGGAGCAGGAGAATGAGGTGGCAAGAGCTTTATACTTGGGCAAGTCACAAGGGAGTTCTGA
GCAAAAGACAATTAGTAGCTTGGTTTTTCCTATATTGTCTGAGAATCAGAAAGAAGAGTTTCCGAGGTTGCCACCAGTAA
AGCTCAAGTCAGAGGACAAACCACTGACTGTTAACTGGGAGGAAAAGTTTGAGCGAGACGGGCCTGGTGCAAAACTCAGT
GCTGCCGACAATGCCCATCTTATTGGGGCATATTTGGATGTCCCTTTTGGACAAGAAATAAGCTCTTCAGGTCCAGGTGG
AAAAAGGAATGTAGGAGGAGGTAGTTGGCTGTCTGTAAGTCAGGGAATTGCAGAAGATACATCTGATCTGGTTTCTGGTT
TCGCTACTGTTGGTGATGGACTGAGTGAAGATTACCCAAACGAGTACTGGGATTCTGATGAATATGATGATGATGATGAT
GTGGGATATATGAGACAACCTATTGAAGATGAGGCCTGGTTCCTGGCTCACGAAATTGATTACCCAAGTGACAATGAAAA
AGGAGCAGGGCATGGGAGTGTTCCAGATCCGCAGGAAAGAGGCCCAACCAAAGATGAGGATGATGATCAATCTTTTGCTG
AAGAGGATTCTTACTTTTCTGGTGAGCGCTACTTTCAAGGGAAAAATGTTGAACCAGTTACAGATGATCCTATGGGAATT
ACAGTGACTGAGTTGTATGGGAGGACTGATGAGAATGATTTAATAGCTCAATATGATGGACAGTTGATGGATGAAGAGGA
ACTGAATTTGATGCGTGCAGAACCTGTCTGGCAGGGATTTGTCACTCAGACTAATGAACTCATTATGTTAGGGGATGGGA
AAGTTATGAATGAGTTGGGAAGGCCACGTCTGGATGATGTTTGTGTGGAGGATGACCAGCTTGGTTCAGTGAGATCAATT
GGTGTGGGGATCAACAGTGATGTTGCTGAAATGGGCAGTGAAGTACGAGAAAGTTTGGTTGGAGGTAGTAGTGAAGGAGA
TTTAGAGTACTTCCGTGACCATGATGAAGGAATTGGTGGGTCTCGGAAGCCTCATCATGACTCGGACAAAAAACATATTG
ATAGATCTAACAGGGACAAAAAGAAAAGTAGTAAACATGAGGCAAATAAATATATAGTTGTTGCCGATGACGATAGTGCA
TCTAGACCCAAGAAAAGTCATACAGAGGGGGCATTTTCATTCCCCCCTCCACTGAGAGATGGAGAACAGTCAGTGCAGGC
AAGCTCTAGTAAATCTTTATGGTCAAACAATTGCAATATAATTGTCACTGATGAAACTGATGACTGTACAAATACTTTGC
TGAGTAACGATGACATGCTTGCTTCATGGAAGCGGAAAAGTACTGATACCTCACCTGATGAAAATAATGATGATGCTGTT
AGATCCAGAAACTCTACGCCCTCGACACTCTCTAATTATGCCTATGCTGAAAGAGAGCATGGCAAGCAAGAAGAAGATGA
AAAGATTGCGGCTCTTAGGGAAGAAGATACAGGGGTGTCACTTGAGGATGAAGAGGCAGCTGCTGTGCAAGAGCAAGTAA
GGCAAATAAAAGCTCAGGAGGAAGAAACTGGCTTCGAGGAGGACAAAAATTTTCATGTTGTTCTGAATTCTGTGATAGCA
GGGCGCTATCATGTCACTGAATATCTTGGATCTGCTGCATTCAGCAAAGCTATACAAGCACATGATTTGCATACAGGAAT
GGATGTGTGTGTGAAAATTATAAAAAACAACAAAGATTTCTTTGATCAGAGCCTTGATGAGATTAAGCTTCTCAAGTATG
TCAATAAGCATGATCCTGCTGACAAGTACCACCTTCTTCGATTGTACGATTACTTTTATTATCGAGAGCATTTGTTAATA
GTATGTGAACTTCTCAAAGCAAACTTGTACGAATTTCATAAATTCAACCGTGAGTCAGGAGGGGAGGTCTACTTCACTAT
GCCAAGACTGCAGTCGATTACCATTCAGTGTCTTGAAGCGCTGCAGTTCTTGCATGGCCTTGGCTTGATACATTGTGACT
TGAAGCCTGAGAATATACTAGTGAAAAGCTACAGTAGATGTGAGGTAAAAGTCATTGATCTTGGGAGTAGTTGCTTTGAG
ACGGATCACCTCTGCTCCTATGTTCAGTCCAGGTCCTATCGCGCTCCTGAGGTTATCTTGGGACTTCCATATGACAAGAA
GATAGATATATGGTCACTTGGGTGTATCTTAGCCGAACTTTGTACTGGCAATGTACTCTTCCAGAATGATTCACCTGCAA
CTTTGCTTGCTCGGGTGATGGGAATCATTTGCCCTATTGATCAAAGTATGCTTGCCAAAGGACGGGATACGTACAAATAC
TTCACAAAAAATCACATGCTTTATGAGCGAAATCAGGAAACTAACAGACTGGAATACCTGATACCGAAAAAGACATCTTT
AAGGCATCGACTGCCAATGGGCGACCAAGGGTTCATTGATTTTGTTGCTCATTTGCTTGAGATAAACCCAAAGAAGCGAC
CTTCTGCAGCTGAGGCTCTGAAGCACCCATGGCTGTCATATCCTTATGAACCCATATCATCTTGA