Details for Strawberry Locus mrna09305

Position : LG5 ( 5`- 9618155 .. 9621409 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09305

Protein [Map View]
MVISSTSGDRSDHFLDCTFASRYVRNPVPKFRMPESSQPKEAAYQIINDELMLDGTPRLNLASFVTTWMEPECEKIMMAS
MNKNYVDMDEYPVTTELQNRCVNMISHLFNAPIGEAETAIGVGTVGSSEAIMLAGLAFKRKWQHRRKLEGKPFDKPNIVT
GANVQVCWEKFARYFEVELKEVKLSDGYYVMDPVKAVEMVDENTICVAAILGSTLTGEFEDVKLLNDLLIKKNKETGWET
PIHVDAASGGFIAPFLYPDIEWDFRLPLVKSINVSGHKYGLVYAGVGWVVWRSKEDLPDELVFHINYLGSDQPTFTLNFS
KGSSQIIAQYYQFIRLGFEGYKNVMENCMENARALKEGLLSTGRFKILSKDIGVPLVAFTLKDSSKHTVFEIADTLRKYG
WIVPAYTMPANAEHVAVLRVVVREDFSRSLAERLLSDIDKVLKEIDTLPSRVSMKAAHVSATVDEVVNASEGMVNAAKKS
IEEIQKEVATYWKNLVERKRTGAC*

DNA
ATGGTGATCTCTTCGACCTCCGGTGACCGTTCAGATCACTTTCTGGACTGCACCTTTGCTTCCAGATATGTGCGCAATCC
CGTCCCCAAGTTCAGGATGCCGGAGAGTTCACAACCCAAAGAGGCAGCTTATCAGATAATAAACGACGAGCTTATGCTGG
ATGGGACTCCGAGGCTCAACTTGGCCTCATTTGTGACCACCTGGATGGAGCCGGAATGCGAAAAAATCATGATGGCCTCC
ATGAACAAGAACTATGTCGACATGGATGAGTACCCTGTCACCACTGAACTTCAGAATCGCTGTGTGAATATGATTTCCCA
CCTTTTCAATGCTCCCATCGGAGAAGCTGAAACTGCTATTGGTGTGGGAACGGTAGGATCTTCAGAGGCAATAATGCTAG
CAGGCCTGGCTTTTAAAAGAAAATGGCAGCACAGGAGAAAATTAGAAGGCAAACCCTTTGACAAACCCAACATTGTGACT
GGAGCTAACGTGCAGGTTTGCTGGGAAAAGTTTGCTAGGTATTTCGAGGTCGAACTGAAGGAGGTGAAGCTATCAGATGG
ATACTATGTGATGGACCCTGTCAAAGCAGTTGAGATGGTTGATGAGAACACTATCTGTGTTGCAGCTATTCTAGGTTCAA
CCCTGACGGGAGAGTTTGAGGATGTGAAACTCCTTAATGACCTTCTTATTAAGAAGAATAAGGAGACAGGATGGGAAACT
CCCATTCATGTTGATGCTGCCAGTGGAGGCTTTATAGCTCCATTCCTTTATCCTGATATTGAGTGGGACTTCCGTTTGCC
ATTAGTCAAGAGTATCAATGTAAGTGGCCACAAGTATGGCCTTGTATATGCTGGTGTTGGATGGGTTGTGTGGAGGAGTA
AAGAGGACTTGCCCGATGAGCTTGTGTTTCACATCAATTATCTTGGATCTGACCAACCAACTTTCACCCTCAACTTTTCC
AAAGGGTCTAGCCAGATAATTGCTCAGTACTATCAGTTTATACGTCTGGGATTTGAGGGTTACAAAAATGTGATGGAAAA
CTGCATGGAGAATGCAAGAGCACTGAAAGAAGGACTATTGAGTACAGGTCGATTTAAAATTCTTTCAAAAGACATAGGAG
TGCCCCTTGTGGCTTTCACTCTAAAAGACAGCAGCAAGCACACTGTGTTTGAGATAGCTGATACTTTGAGAAAGTATGGA
TGGATAGTTCCAGCCTACACTATGCCAGCCAATGCAGAACATGTTGCTGTTCTTCGCGTGGTTGTCAGGGAGGACTTTAG
TCGGAGCTTGGCAGAGAGACTCCTCTCAGACATCGACAAGGTTTTGAAAGAAATCGACACACTGCCAAGCCGCGTGTCTA
TGAAAGCTGCACATGTCTCGGCTACTGTCGACGAAGTAGTCAATGCCAGTGAAGGGATGGTAAATGCTGCTAAGAAAAGT
ATAGAGGAGATTCAGAAAGAGGTAGCAACATATTGGAAGAACCTTGTGGAAAGAAAGAGAACAGGTGCATGCTAG