Details for Strawberry Locus mrna09298

Position : LG5 ( 5`- 9570017 .. 9576804 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09298

Protein [Map View]
MADDERDEVPMLSDTHPQSSNEHLALQIERFISRTRSASISIPMNSMDSYERDEVNLVGHTGPLRTHTKTPFLAMSGPLY
ANQGRPDNVLRLPQGVTDQEAAETQTTAEKFPYTNTTNESEWNDEYAAKNGHLLRSGQLGMCNDPYCTTCPTVYKATRPK
HLRPSGIFDHKFQNAFYGDAKGWARSFFSCLRPYIPGVMNPHTKIVQQWNQFFVISCLVAIFVDPLVFFLLSVQEDNKCI
VIDRPLTTTFVVFRSITDLIYFMHILLQFRLAYVAPDESRVVGAGVLVDHPKKIALNYLKGYFLIDFFVVLPLPQIILLL
VLPRNLGSSGANYAKNLLRAAVLLQYIPRLCRFLPLVAGQSPSGFIFESAWANFIINLLTFVLSGHVVGSGWYLFGLQRV
NQCFRDACHNSTIVGCMSFIDCGYGSNSEGPKGVEETLWKNNENATACLNGTGFDYGIYIKAVGLTTEDSVITRYVYALF
WGFQQISTLAGNLTPSYFVWEVLFTMAIIGLGLLLFALLIGNMQNFLQALGRRRLEMSLRRRDVEQWMSHRRLPNELRRR
VRQAERYNWAATRGVNEEMLLEVLPEDLQTDIRRHLFKFIKKVRIFALMDEPILDSICQRLRQKTYIQGSKVLYRGGLIE
KMVFIVRGQMESIGEDGIRVSLCEGDVCGEELLTWCLEHSSVNKDGKKIRIPGQRMLSNRTVLCITNIEAFSLRAADIEE
VTSLFARFLRKPRVQGAIRYESPYWRGLAARCIQVAWRYRKKRLNRADTSQSNHAHS*

DNA
ATGGCTGATGATGAAAGAGATGAGGTACCTATGCTTTCGGATACTCATCCACAATCATCAAATGAGCACTTGGCATTACA
GATTGAGAGATTTATATCCAGGACCCGGAGCGCATCAATTTCCATTCCTATGAACTCTATGGACTCATATGAAAGGGATG
AAGTTAACCTTGTAGGCCATACTGGTCCCTTAAGGACTCACACAAAAACGCCATTCTTAGCTATGAGTGGTCCGTTATAT
GCTAACCAGGGCAGGCCTGATAATGTTCTGCGGCTACCTCAAGGTGTGACAGATCAAGAAGCAGCAGAAACTCAAACTAC
AGCAGAAAAGTTTCCTTATACTAATACAACAAACGAGAGTGAGTGGAATGACGAGTATGCTGCAAAAAACGGACATTTAC
TGAGATCTGGTCAATTGGGGATGTGCAATGATCCTTACTGTACAACTTGTCCAACTGTCTATAAGGCTACTCGACCAAAA
CACTTGAGGCCCTCTGGTATATTTGACCACAAGTTCCAGAATGCTTTCTATGGTGATGCCAAGGGATGGGCGAGGAGCTT
TTTCTCATGTCTGCGTCCATATATTCCTGGAGTTATGAATCCTCATACTAAAATTGTGCAGCAGTGGAACCAGTTCTTTG
TCATTTCTTGCTTAGTTGCAATTTTTGTAGATCCATTGGTTTTCTTCCTGCTGTCTGTTCAAGAGGATAATAAATGTATA
GTTATTGATCGGCCATTGACCACTACTTTTGTGGTTTTCAGAAGCATAACTGATCTCATATACTTCATGCACATACTTCT
CCAGTTTAGATTGGCTTATGTGGCTCCTGATGAGTCTAGAGTAGTTGGTGCTGGAGTGTTAGTTGACCATCCAAAGAAAA
TTGCTCTCAATTACCTTAAAGGATATTTCCTGATTGACTTCTTCGTTGTATTACCACTACCACAAATCATATTATTGCTA
GTTCTGCCAAGAAACTTGGGATCATCTGGAGCAAACTACGCAAAAAATCTTTTACGTGCTGCCGTTCTTCTTCAGTATAT
TCCCAGATTGTGTAGGTTTCTACCTCTGGTTGCTGGGCAGTCTCCAAGTGGCTTCATATTTGAATCAGCATGGGCCAATT
TTATAATAAATCTTCTCACGTTTGTCTTGTCTGGCCACGTCGTCGGGTCAGGCTGGTACCTCTTCGGATTACAGAGGGTT
AATCAATGTTTTCGAGATGCCTGCCACAACTCTACAATTGTTGGATGCATGAGCTTCATAGACTGTGGGTATGGAAGTAA
CAGTGAAGGTCCTAAAGGGGTCGAAGAAACACTCTGGAAAAACAATGAAAATGCTACTGCTTGTTTGAATGGAACTGGTT
TTGACTACGGAATCTACATCAAAGCTGTTGGCCTTACAACAGAAGATAGTGTAATCACTCGATATGTATATGCGTTGTTT
TGGGGATTTCAGCAAATCAGTACTCTGGCTGGAAACCTAACTCCAAGCTATTTTGTGTGGGAAGTCCTCTTCACAATGGC
CATTATTGGCCTAGGTCTATTGCTTTTCGCTCTGCTCATAGGAAATATGCAGAACTTTCTGCAGGCTCTTGGGCGGAGAA
GGTTAGAAATGTCACTGAGACGTCGTGATGTTGAGCAGTGGATGAGCCATAGACGTTTGCCGAATGAACTAAGGAGGCGA
GTACGCCAAGCTGAAAGGTACAATTGGGCAGCTACCAGAGGGGTAAATGAAGAAATGCTTTTGGAAGTCTTGCCTGAAGA
CCTTCAGACAGATATAAGAAGACATCTGTTCAAGTTTATTAAGAAAGTACGGATTTTCGCCCTCATGGATGAACCGATCT
TAGATTCCATTTGCCAAAGACTAAGACAAAAGACATACATCCAAGGAAGCAAAGTTTTGTACCGTGGTGGTCTAATTGAG
AAGATGGTCTTTATTGTGCGAGGGCAAATGGAGAGCATTGGAGAAGATGGCATTAGAGTTTCTCTATGTGAAGGTGATGT
TTGTGGTGAGGAACTTCTCACATGGTGTCTTGAGCATTCATCGGTAAACAAAGATGGTAAAAAGATCAGGATTCCTGGAC
AGCGAATGCTAAGCAACAGGACAGTTCTATGCATAACGAACATTGAAGCATTTTCACTAAGAGCTGCTGACATTGAAGAA
GTCACCAGCCTCTTTGCTAGATTCTTGCGCAAACCACGAGTTCAAGGAGCCATAAGGTATGAGTCACCTTACTGGAGAGG
TCTTGCGGCAAGATGCATTCAAGTGGCTTGGAGATACAGGAAAAAGCGACTTAATCGTGCAGACACTTCTCAATCCAATC
ATGCTCATAGTTAA