Details for Strawberry Locus mrna09183

Position : LG5 ( 5`- 9450604 .. 9453147 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09183

Protein [Map View]
MVLCVSNVDVVTMGKPAASSSSSSSSASSVQTHHDSAPASPTSTRKMSLISTNPTTMATTAKPTWLLSNLADVEERMKMV
ALNSNSKSTKTPEDQDTGDTFAERAEAYYKTRPQLLSLLQDLYNSYLTLSDRYIQTIAKTTSLSQSQSFHPPRRQSSQTS
TIEYYDYYELQDQYETSQNDSDVESTVSYQQHLLSLLAQDDNDDNTTMASFDAIVAEIVIKNVECDILLHEVNASERQQN
ESSRKIELQKSLLEVLESERLILLNENSKLGYRVGALVEENKALASESMFMRRKAGELARCLLQMREDRRVSMLSRKIED
LQGQIYGLEKRNKEYYQQLVSKDHSQQGSVEEERISSINKKKTRKGIGRSSNEVDLHVCFQIGKTKRRGGTVTRGTGADK
KGSSWWGKIKNMDLFLCGLNPTSAA*

DNA
ATGGTTCTGTGTGTCAGTAACGTCGACGTGGTGACAATGGGGAAACCAGCAGCATCATCATCGTCGTCGTCGTCATCTGC
TTCTTCTGTTCAAACTCATCACGACTCAGCTCCGGCTAGTCCAACAAGCACAAGGAAGATGAGCTTAATAAGCACCAACC
CGACCACCATGGCCACCACCGCCAAACCGACCTGGCTCCTCTCCAACCTTGCCGATGTGGAAGAGAGGATGAAGATGGTA
GCATTGAACAGTAACAGTAAAAGTACTAAGACTCCTGAAGATCAAGACACTGGGGACACCTTCGCGGAGAGAGCTGAAGC
TTACTACAAAACACGCCCTCAGCTGCTCTCCCTACTTCAAGACCTGTACAATTCCTATCTCACACTATCTGACCGTTACA
TTCAAACAATCGCCAAAACTACTAGTCTGAGTCAGAGTCAGAGTTTCCATCCTCCTCGTCGACAATCTTCTCAGACCTCA
ACCATTGAATACTATGATTACTATGAACTGCAAGATCAATATGAAACTAGCCAGAATGATTCAGATGTGGAGAGTACCGT
CTCTTATCAGCAACATCTCTTATCACTACTTGCTCAAGATGACAATGATGATAATACCACCATGGCATCCTTTGATGCAA
TTGTCGCGGAGATTGTGATAAAAAATGTGGAATGTGATATTCTACTTCATGAGGTCAATGCATCAGAGAGGCAACAAAAT
GAATCGTCGAGGAAGATAGAGTTGCAGAAGAGCTTGCTTGAGGTTTTGGAGTCTGAAAGGCTCATCCTACTGAATGAGAA
TTCTAAATTGGGTTACAGAGTGGGTGCATTGGTGGAAGAGAACAAAGCTCTTGCTTCTGAGTCTATGTTCATGAGGAGGA
AGGCCGGTGAGCTAGCTAGGTGTTTGCTCCAAATGAGAGAGGATCGCAGGGTCAGCATGCTCAGCCGTAAGATAGAGGAC
CTCCAGGGACAGATTTATGGACTGGAGAAGCGCAACAAGGAGTACTACCAGCAACTTGTCAGTAAAGACCACTCGCAACA
AGGATCAGTTGAAGAAGAGAGGATTAGTAGCATCAACAAGAAGAAGACAAGAAAGGGGATTGGTAGAAGTAGTAATGAGG
TGGATTTGCACGTTTGTTTCCAAATAGGGAAGACGAAGAGGAGAGGTGGTACTGTTACGAGGGGTACTGGCGCCGACAAG
AAAGGTTCTAGTTGGTGGGGAAAGATCAAGAACATGGACTTGTTTCTGTGTGGACTTAACCCAACTTCTGCTGCTTGA