Details for Strawberry Locus mrna09180

Position : LG5 ( 5`- 9426989 .. 9431711 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna09180

Protein [Map View]
MNKASVSKELDAKHAKILEGLLKLPENRECADCRSKAPRWASVNLGIFICMQCSGIHRSLGVHISKVRSTTLDTWLPEQI
AFMESLGNEKANHYWEKELPPNEDRSEIEKFIRAKYEGKKWVAKNAKQPAPELVEMGTSSNKLVEGGATSGKKLRRHSLE
EAVLPTRLAEDAPPVARPRTVSLDLNHTLTSSPLPKGPAPMTDCNTATTKSNGETNLFNLLHVHDAKQECVTVPPARWAT
FDSPGINVWPAADIKVRVVLDVGSVCSWEEMWDWTDLKYEIEIHRHTSFSMVLRYVFCFSLFLFLSLDSYLKEGRVVGYV
HLTEGYL*

DNA
ATGAACAAGGCTTCCGTTTCCAAGGAGCTCGATGCCAAGCACGCCAAGATTTTAGAAGGTCTTCTTAAGCTGCCGGAAAA
CCGGGAATGTGCTGATTGTCGGAGCAAAGCCCCACGATGGGCAAGCGTGAACCTGGGAATATTTATTTGCATGCAATGTT
CAGGAATCCATCGGAGCCTTGGAGTGCACATTTCAAAGGTCCGGTCTACTACTTTGGATACATGGCTGCCAGAGCAGATT
GCTTTTATGGAATCTTTGGGTAATGAAAAGGCAAACCATTATTGGGAAAAAGAGTTGCCACCAAATGAAGACAGAAGTGA
GATTGAGAAGTTTATTCGTGCCAAGTATGAGGGGAAAAAGTGGGTTGCGAAGAATGCAAAACAGCCCGCTCCTGAACTAG
TTGAAATGGGCACCAGTTCCAACAAGTTGGTAGAAGGTGGAGCCACCAGTGGGAAGAAACTAAGGAGGCATTCTCTTGAG
GAAGCAGTACTTCCTACGCGTCTTGCAGAAGATGCTCCTCCAGTAGCAAGACCCCGCACGGTTTCTTTAGATTTGAATCA
CACGTTGACTAGTTCACCTCTACCAAAGGGGCCAGCACCGATGACAGATTGTAATACAGCAACAACAAAGAGCAATGGTG
AAACAAATCTCTTCAATTTGCTTCATGTCCATGATGCAAAACAGGAATGTGTAACTGTACCTCCTGCACGCTGGGCAACT
TTCGATTCCCCTGGGATTAATGTTTGGCCAGCTGCTGACATTAAAGTCAGAGTGGTACTTGATGTGGGCAGTGTTTGTTC
CTGGGAAGAAATGTGGGATTGGACAGATCTCAAGTATGAAATAGAAATACATCGCCACACATCCTTCTCCATGGTGCTGA
GATATGTTTTCTGTTTCTCTTTGTTTCTTTTCTTGAGTCTGGATTCATATTTGAAAGAAGGTAGGGTTGTAGGGTATGTA
CACCTCACAGAAGGTTATCTGTAA