Details for Strawberry Locus mrna04417

Position : LG6 ( 5`- 33550912 .. 33554428 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna04417

Protein [Map View]
MKFGKEFVSQMVPEWQEAYLDYNSLKALLKDLLRFVQTRTPTSMASTPNGSALNRRVSLYRAFSGLTSRHRESPRAKEDE
EILVSEDGEDGRYHTFVTVSDEERGYEVKFFNRLDDEFNKVVRFYKMKVKEVVEEADELSRQMDTLIALRLKVDNPMVDF
GDGPNCAVHPINGRRAGGQHMDVIEEVETLENLERGENEPKTRKQEANGGIKGFKPPQLEILEHVKINVTPKTPRSTLKG
CLNSDKQDLFSKKELRKAEEQMKQAFSEFYQKLRLLKSYCFLNQLAFSKIMKKHDKITSRNASKVHLHMMETSYLGTCDD
VTRLMERVETTFIKHFANGNHRKGMKTLRPTARREKHRSTFFLGLFSGCSVALVVAIIVLIHARGLLESEGRDLYMENIF
PLYSLFGFIVLHIVVFSANIYYWRRYRVNYSFIFGFKKGTELGYRQSFLMSSGLAVLALAGVLSNLDMEMDPRTKTFEAW
TELVPLGLVIVVIGIILCPFNIMYRSSRFFLIQAVVHCVCAPLYKVTLPDFFLADQLTSQVQAFRSLEFYVCYYGWGDFL
KRSHNCLDSNVYKTFYFIVAIIPYWIRSLQCLRRLVEEKDGMQGLNGLKYFSTIVAVAMRTSFDMKKGMTWKILAMTSSI
VATLVSTYWDIVIDWGLLQRNSENRWLRDKLLIPNKSVYFVAMVLNVLLRLAWMQSVLGFREAPYIHRTALVAIVACLEI
IRRGIWNFFRLENEHLNNVGKYRAFKSVPLPFNYYHDEGKSR*

DNA
ATGAAGTTTGGGAAGGAGTTTGTGTCTCAAATGGTGCCGGAATGGCAAGAAGCCTACTTGGACTACAACTCACTCAAGGC
TCTCTTGAAAGACCTCTTGCGTTTTGTACAGACCAGAACACCAACATCAATGGCTTCAACTCCAAATGGTTCAGCTTTGA
ATAGAAGGGTTTCTCTTTACAGGGCCTTTAGTGGGCTGACAAGTCGGCATAGGGAGTCTCCGAGGGCAAAAGAGGATGAG
GAGATTCTTGTTAGTGAAGACGGGGAGGATGGGAGGTACCATACATTTGTGACGGTCTCGGATGAGGAAAGAGGGTATGA
GGTTAAGTTTTTCAATAGGCTTGATGATGAGTTCAACAAAGTGGTGAGGTTTTACAAGATGAAGGTGAAAGAAGTGGTGG
AGGAGGCTGATGAGTTGAGTAGGCAGATGGATACTTTGATTGCTCTGAGGCTCAAGGTTGATAATCCAATGGTGGATTTT
GGGGATGGTCCAAATTGTGCTGTTCATCCCATCAATGGTAGAAGAGCAGGAGGGCAGCATATGGATGTGATTGAGGAAGT
AGAGACGTTGGAAAATTTGGAGAGAGGAGAGAATGAACCAAAAACTAGAAAGCAGGAAGCCAATGGAGGTATTAAGGGAT
TTAAACCTCCTCAACTGGAGATTCTTGAACATGTAAAGATCAATGTCACGCCCAAAACTCCGAGGTCAACTCTGAAAGGC
TGCCTCAACAGTGACAAACAAGACTTGTTCAGCAAGAAGGAACTGAGGAAAGCAGAAGAGCAAATGAAACAGGCTTTCAG
TGAGTTCTACCAAAAGCTTCGGCTTTTGAAAAGTTACTGTTTCTTGAACCAATTGGCTTTCTCAAAGATCATGAAGAAGC
ATGACAAGATCACTTCGAGGAATGCATCAAAGGTTCACTTGCACATGATGGAAACCTCTTATCTTGGGACGTGTGATGAT
GTTACTAGGCTTATGGAAAGGGTGGAGACTACCTTCATAAAGCACTTCGCAAACGGAAACCACAGAAAAGGAATGAAGAC
ATTAAGACCAACAGCCCGAAGGGAGAAGCATAGAAGTACATTTTTCTTGGGACTGTTCTCTGGGTGTTCAGTTGCTCTTG
TAGTAGCCATTATAGTGCTTATACATGCAAGAGGTCTCCTTGAAAGTGAAGGGCGTGACCTGTACATGGAAAACATATTC
CCTCTTTACAGCTTGTTTGGATTCATAGTCCTTCATATAGTCGTCTTCTCAGCAAACATATATTACTGGAGGCGATACCG
AGTAAATTATTCATTCATCTTCGGCTTCAAAAAAGGCACAGAATTGGGGTACAGACAGTCTTTCCTCATGAGCTCCGGCC
TTGCAGTTCTTGCATTGGCTGGTGTTCTCTCGAATTTGGATATGGAGATGGACCCAAGAACAAAAACCTTCGAAGCCTGG
ACAGAATTAGTCCCTTTGGGCCTAGTCATCGTTGTGATTGGTATAATTTTATGTCCTTTCAACATAATGTATCGTTCCAG
CCGCTTTTTCCTCATCCAAGCTGTAGTACATTGTGTTTGTGCTCCTCTGTACAAGGTTACCCTCCCTGATTTTTTCTTGG
CAGATCAGCTTACTAGCCAGGTTCAGGCCTTCAGGAGTCTGGAATTCTATGTTTGCTATTATGGTTGGGGGGACTTTTTA
AAAAGATCACACAACTGCCTAGACAGCAATGTATACAAAACTTTCTACTTCATTGTAGCAATTATCCCATATTGGATTCG
TTCCCTTCAGTGTCTGAGACGCTTGGTGGAGGAGAAAGATGGAATGCAAGGGTTAAATGGGCTGAAATACTTCTCAACAA
TTGTCGCAGTTGCCATGAGAACAAGTTTTGATATGAAAAAAGGGATGACATGGAAGATCCTAGCTATGACTAGCTCAATT
GTTGCAACGCTTGTCAGTACTTACTGGGATATTGTGATAGATTGGGGTCTCCTGCAACGGAATTCTGAAAACCGTTGGCT
CAGAGATAAACTCCTTATACCAAACAAAAGTGTTTACTTTGTAGCCATGGTGTTAAATGTTCTACTCAGACTTGCTTGGA
TGCAATCAGTACTAGGATTTCGGGAAGCACCATACATCCATAGAACAGCCTTGGTTGCAATAGTTGCCTGTTTAGAAATA
ATTCGCCGTGGCATTTGGAATTTCTTCCGGCTGGAGAATGAGCACTTGAATAATGTTGGGAAGTATCGAGCATTCAAGTC
TGTACCCCTACCTTTCAACTATTATCATGATGAAGGCAAGAGCAGATAA