Details for Strawberry Locus mrna04416

Position : LG6 ( 5`- 33547793 .. 33549552 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna04416

Protein [Map View]
MAVSMRFELQSGQTKCISDEIKSNSMTVGKYSIVNPNEGFPLPDSHKLTVRVTSPYGNNYHHGDLVASGNFAFTAAETGD
YSACFWVIDHKPKATVIIDFDWKTGVAAKDWSKVAKKGQIELMELELKKLFDTVMAIHDEMFYLREREEEMQQLNRSTNS
KMATLSFLSLVVCLSVAGLQLWHLKMFFERKKLL*

DNA
ATGGCGGTTTCTATGCGGTTCGAGCTTCAATCTGGCCAAACGAAATGCATCTCAGACGAAATAAAAAGCAATTCAATGAC
TGTGGGCAAGTACTCTATTGTTAATCCCAATGAGGGCTTTCCTCTTCCTGATTCGCACAAGCTTACTGTCAGGGTGACCT
CACCTTATGGGAATAATTATCACCATGGGGATCTTGTGGCTTCGGGTAATTTTGCCTTCACTGCGGCGGAGACTGGTGAT
TATTCGGCTTGCTTTTGGGTAATTGATCACAAGCCAAAGGCCACGGTGATTATTGATTTTGACTGGAAAACTGGTGTTGC
TGCCAAGGACTGGTCCAAGGTTGCCAAGAAAGGGCAGATTGAACTGATGGAACTTGAGCTTAAAAAACTGTTTGATACTG
TGATGGCCATTCATGATGAGATGTTTTATCTTCGTGAAAGGGAGGAAGAAATGCAACAACTTAATCGATCAACTAACTCC
AAGATGGCGACGCTTAGCTTCCTTTCCCTTGTAGTTTGCTTGTCTGTTGCTGGTTTGCAATTATGGCATCTCAAGATGTT
CTTTGAGAGGAAGAAGCTCCTCTAG