Details for Strawberry Locus mrna04402

Position : LG6 ( 5`- 33497699 .. 33499973 -3` )
Annotation :
External links : CoGe
PGDD synteny : mrna04402

Protein [Map View]
MSEVFEGYERHYSEISANLSKKCTIAGGLHGEQKKQKISEVKAGIDEAESLIRKMDLEARSLQPNVKAVLLAKLREYKSD
LNNLKSEVKRLVSGNLNASARDELLESGMADALTASADQRTRLMTTTEKLDKTSDRVKNSRRTMLETEELGVSILQDLHS
QRQSLLHAHGTLHGVDDNIGKSKKILTSMTRQMNKNKWIISSIIVVLVIAIALILYFKLR*

DNA
ATGAGTGAGGTATTCGAAGGATACGAGCGCCATTACAGCGAGATTTCCGCTAATCTCAGCAAGAAGTGTACAATAGCTGG
TGGGCTTCATGGAGAGCAAAAGAAGCAAAAGATATCTGAAGTAAAGGCTGGAATAGATGAAGCAGAATCTTTGATCAGGA
AAATGGACCTTGAGGCAAGAAGTTTGCAGCCAAATGTCAAGGCTGTGCTTCTTGCTAAGTTGCGGGAATACAAATCAGAT
CTGAACAATCTGAAAAGCGAAGTTAAAAGACTTGTATCTGGCAACTTAAATGCATCTGCCAGGGATGAGTTGTTGGAATC
GGGCATGGCTGATGCTTTGACGGCATCAGCAGATCAGAGAACACGGTTGATGACGACGACAGAGAAATTAGACAAGACCA
GTGATAGAGTTAAGAACAGTAGAAGAACCATGCTGGAAACAGAAGAGCTTGGTGTTTCAATCCTTCAAGATTTGCATTCA
CAGCGACAGTCTCTTTTACACGCTCATGGCACGCTTCACGGAGTGGATGACAACATAGGTAAGAGCAAGAAAATTTTGAC
ATCCATGACAAGGCAGATGAACAAGAACAAGTGGATAATTAGCTCTATTATTGTGGTTCTCGTCATTGCTATCGCCTTGA
TCTTGTACTTCAAACTTAGATAG