Details for Papaya Locus evm.TU.supercontig_3.368

Position : sup3 ( 5`- 2493996 .. 2495077 -3` )
Annotation :
External links : CoGe
PGDD synteny : evm.TU.supercontig_3.368

Protein [Map View]
MRGLSFCLANFANLLYYLFPFFERIPVKFMSLQIENMVTLVSRTGRELQRYEKGSRLVVGCIPYRYKKKQSSFDGTLIEE
LEVLMISAQKGQAMLFPKGGWELDESMEQAALRETIEEAGVIGDIERKLGKWRYKSKSQGIIHDAYMFPLLVKKQLDIWP
EKSIRNRRWMTVKEARESCKNWWMRDALDEFVHRKNLS

DNA
ATGAGAGGATTATCTTTCTGTCTTGCGAATTTCGCTAATCTGCTTTACTATCTTTTCCCTTTCTTCGAGAGGATCCCCGT
GAAATTCATGTCCTTGCAAATTGAGAACATGGTCACTTTGGTTTCTCGAACTGGCCGTGAATTGCAGCGGTACGAGAAGG
GCTCGCGACTCGTTGTTGGATGCATTCCTTACAGATATAAGAAAAAGCAATCATCTTTTGATGGAACCCTTATTGAAGAA
CTGGAAGTTCTTATGATCAGTGCACAAAAGGGTCAAGCAATGTTGTTTCCAAAGGGTGGTTGGGAACTTGATGAATCCAT
GGAACAGGCAGCTTTGAGGGAGACAATTGAGGAAGCTGGTGTGATTGGTGATATAGAAAGGAAACTGGGGAAATGGAGAT
ACAAGAGCAAAAGCCAGGGCATAATTCATGACGCCTACATGTTTCCTTTGCTTGTTAAGAAGCAGTTGGATATTTGGCCA
GAGAAAAGTATCCGGAATCGGAGATGGATGACTGTCAAGGAAGCGAGAGAATCATGCAAGAATTGGTGGATGAGAGATGC
TTTGGATGAATTTGTTCATAGAAAGAACCTATCCTAA