Details for Papaya Locus evm.TU.supercontig_3.339

Position : sup3 ( 5`- 2353157 .. 2348380 -3` )
Annotation :
External links : CoGe
PGDD synteny : evm.TU.supercontig_3.339

Protein [Map View]
MIYSRATTIVIPREIRVPDYPVKWSGFSVNKKQRNTQYSVVNPPFFDWKGLTKLSCNSMTIEACSKHMGEAPALILTSGA
SGRISALFSLRVLRSLLMLVDAFVLLLLVPFRGRRRTATLNSANRSDDKQEGSVGSTKKGGPVVRVPAIVAWRSSSSSSS
GMVTVDQEVAMRRALAIRRVVQDEGNDVVRGFSLFVTARGDTLFTQSWTPVSLKIRGVVVLLHGLNEHSGRYSDFAKQLN
ANGFKVYGIDWIGHGGSDGLHAYVHSLDDAVADMKSFLEKVLAENPGFPCFFFGHSTGAAIVLKAMLDPKIEARVAGVVL
TSPAVGVQPSHPIFTVLAPIVSFLMPRYQFSAANKQGMPVSRDPEALVAKYSDPLVYTGSIRVRTGYEILRIASYLQQNL
NRLTVPFLVLHGTADTVTDPGASEKLYQEASSIDKTIKLFEGFLHDLLFEPEREAIVSDIIEWLKSRV

DNA
ATGATCTATTCGAGAGCGACGACGATTGTAATACCTAGAGAAATTCGAGTTCCAGATTATCCTGTAAAGTGGTCTGGTTT
TTCTGTAAACAAAAAGCAGAGGAATACCCAGTACTCCGTTGTTAATCCTCCGTTCTTCGACTGGAAGGGCTTGACGAAGC
TCTCTTGCAATTCAATGACGATCGAGGCGTGTTCGAAGCACATGGGTGAAGCTCCGGCTTTGATTTTGACATCCGGTGCA
AGCGGACGCATAAGCGCTTTATTTTCGCTGCGCGTATTGAGGAGTCTGTTGATGCTAGTCGACGCGTTCGTTTTGCTGCT
TTTGGTGCCGTTCCGAGGGAGGAGACGGACGGCGACGTTGAATTCCGCGAACAGATCAGATGATAAGCAGGAGGGCAGCG
TGGGGTCCACCAAAAAGGGGGGCCCAGTGGTGCGGGTGCCGGCGATCGTGGCGTGGAGGAGTAGCTCGTCGTCGTCGTCG
GGAATGGTGACGGTAGACCAGGAGGTGGCAATGAGACGAGCGCTGGCGATACGGAGAGTGGTGCAGGATGAAGGAAACGA
CGTCGTTAGAGGGTTTTCGCTTTTCGTCACCGCCAGAGGAGACACGCTCTTCACGCAGTCATGGACTCCCGTTTCCCTCA
AAATCAGGGGAGTGGTTGTTCTTTTGCATGGCCTGAATGAACACAGTGGCAGATACAGTGATTTTGCAAAGCAATTGAAT
GCTAATGGATTCAAGGTTTATGGCATTGATTGGATTGGACATGGTGGAAGTGATGGACTGCATGCTTATGTTCACTCTCT
TGATGATGCTGTCGCTGATATGAAATCTTTCCTCGAGAAAGTTTTAGCTGAAAATCCTGGGTTTCCTTGTTTCTTCTTTG
GACACTCAACTGGTGCAGCTATTGTCCTTAAGGCAATGCTTGATCCAAAGATTGAAGCCCGTGTAGCTGGAGTAGTACTG
ACTTCTCCTGCTGTAGGAGTTCAGCCTTCACATCCAATTTTCACAGTGCTTGCTCCAATTGTCTCATTTTTGATGCCAAG
GTACCAATTCAGTGCAGCAAATAAGCAGGGCATGCCAGTGTCTAGAGACCCCGAGGCACTAGTGGCCAAATACTCAGATC
CCTTGGTCTACACTGGATCCATCAGGGTGAGAACTGGGTATGAGATTCTTCGAATTGCATCCTATTTGCAGCAAAATCTC
AACAGATTGACAGTACCATTTCTTGTCCTCCATGGAACTGCTGATACTGTCACTGACCCTGGAGCTTCTGAAAAGCTGTA
TCAAGAGGCCTCCTCAATTGACAAAACCATCAAGCTGTTTGAAGGGTTCCTGCATGATCTCCTCTTCGAACCAGAACGAG
AAGCCATTGTCAGTGACATTATCGAATGGTTAAAGAGTAGAGTTTGA