Details for Papaya Locus evm.TU.supercontig_19.62

Position : sup19 ( 5`- 444822 .. 444043 -3` )
Annotation :
External links : CoGe
PGDD synteny : evm.TU.supercontig_19.62

Protein [Map View]
MACKAIVCGRGVGEGNCSLLRGNPDLRNAPSRSCLLSPITQRRRVRYPSVGKLSVSAAKQERQIRKEEKWRKDDAVSSGE
KVDEWMRESVVDIVKNLTGAPLLVQVYGEDNGTVKTRTEKAEEWGLVKRKWEKGEDQLPEGVIFVEQLEDERRIRKKELL
INNGDRDNDDLDSGNCRCNEEEEEGTRAWGLVVQGRGMDCGPVCYLLKTSRVGSESGSGVGMWCTHFCLVRVSSFRETTE
SQLKNCWLSQLQLQGGHSE

DNA
ATGGCGTGTAAGGCGATTGTTTGCGGACGAGGAGTTGGGGAAGGAAATTGTTCGCTTCTTCGCGGAAATCCGGATCTTCG
CAATGCTCCGTCGCGTTCGTGTTTGTTATCCCCGATAACCCAGCGCCGGCGTGTTCGGTATCCATCCGTCGGGAAGCTTT
CTGTTTCGGCGGCGAAACAAGAGCGGCAGATCCGGAAGGAGGAGAAGTGGAGGAAAGACGACGCCGTTTCGTCGGGGGAG
AAGGTGGATGAGTGGATGAGAGAGTCGGTGGTGGATATCGTGAAGAATCTTACCGGAGCGCCGCTGTTGGTGCAAGTGTA
TGGGGAAGACAACGGGACGGTGAAGACGAGGACGGAGAAGGCGGAGGAGTGGGGATTGGTGAAGAGGAAGTGGGAGAAAG
GAGAGGATCAGTTGCCGGAAGGCGTGATATTCGTTGAGCAATTGGAGGATGAGCGTAGAATCAGGAAGAAAGAGTTGCTA
ATCAACAATGGCGATCGCGATAATGATGATTTGGATTCTGGTAATTGTAGATGTAATGAGGAGGAGGAGGAGGGGACGAG
GGCATGGGGGTTGGTGGTGCAGGGGAGAGGGATGGATTGTGGACCAGTGTGTTACCTGTTGAAGACGAGTAGGGTCGGGT
CGGAGTCGGGTTCGGGTGTGGGAATGTGGTGTACCCATTTCTGTCTGGTGAGAGTGAGTAGTTTCAGGGAGACGACGGAG
AGTCAACTGAAGAATTGTTGGCTGTCTCAGCTCCAATTGCAGGGTGGGCATTCTGAGTAA