Details for Papaya Locus evm.TU.supercontig_19.57

Position : sup19 ( 5`- 418620 .. 421959 -3` )
Annotation :
External links : CoGe
PGDD synteny : evm.TU.supercontig_19.57

Protein [Map View]
MLVMLSMRNLLTLLGLLLLAPLLVRSLNPSLNDDVLGLIVFKADIQDPKQQLASWNEDDDSPCGWYGIKCNPRSNRVTEL
TLDGLSLSGRIGRGLLQLQFLRKLSLSKNNLTGNVSPILLRLENLRIIDLSENGLSGPIPEDFFQQCGSLRAISLANNKF
SGKIPGSLTSCSSLAIFNVSSNQFSGSLPSGIWSLNILRSLDLSSNLLEGEIPKGIDSMNNLRVINLSKNRLSGSVPAGI
GSCLLLKYIDLSDNALSGFLPESMQKLSSCNHLNLRKNSLEGEVPNWLGELRNLENLDLSSNKFSGLVPHSIGNLQSLKM
MNFSANGVTGNLPESLVNCTNLLALDFSQNSMTGDLPGWLFQSNLQHVSLSRTNTGIMDSPFSSSVGNSIQKLQVLDLSH
NSLSGELRIGIRVLGDLQVLNLSRNSLVGNIPASIGEFKDLTVLDLSCNKLNGSIPLEIGGSISLKELRLEGNFLDGKIP
TSIGNCSSLQALILAQNKLDGPVPVEMAKLTNLQDVDLSFNNLTGTLPKQLANLAHLYNFNISHNHLQGELPAGFFNTIS
PYSVSGNPSLCGSAANKSCPAVLPKPIVLNPNSTSEASSGVIAPNLSHKRIILSISSLIAIGAAAVIVIGVIAITVLNLR
VRASASRSAAALALSAGDDFSRSPTTDANSGKLVMFSGEPDFSTGAHALLNKDCELGRGGFGAVYRTVLRDGQPVAIKKL
TVSSLVKSQEDFEREVKKLGKVRHPNLVALEGYYWTPSLQLLISEFVSGGSLYKHLHEGSGANFLSWNERFNIILGTARS
LAHLHQSNIIHYNIKSSNVLIDSSGEPKVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTIKITEKCDVYGFGVL
VLEVVTGKRPVEYMEDDVVVLCDMVRGALEEGKVEECVDGRLQGKFPVEEAVPVMKLGLICTSQVPSNRPDMGEVVKILE
LIRCPLDSPEELV

DNA
ATGCTGGTAATGTTGAGCATGAGAAACCTGCTTACTTTACTGGGGCTGCTGTTATTAGCTCCACTTCTGGTGAGATCTTT
GAACCCGTCTTTAAACGACGACGTTCTGGGCCTAATCGTGTTCAAGGCAGACATTCAAGATCCAAAGCAACAGCTCGCAT
CTTGGAACGAAGACGACGATAGTCCTTGTGGCTGGTACGGTATCAAATGCAACCCGAGATCCAACCGCGTCACGGAGCTC
ACTCTCGACGGATTGTCTCTCTCGGGTCGGATCGGCCGTGGCCTCTTGCAGCTCCAGTTCCTTCGTAAGCTCTCTCTTTC
TAAGAACAACCTTACTGGTAATGTGAGCCCGATACTGCTCAGGCTTGAAAACCTTAGAATCATCGACTTGAGCGAGAATG
GTCTTTCGGGCCCCATCCCTGAAGATTTCTTTCAACAATGTGGGTCCTTAAGAGCAATTTCTTTGGCAAACAACAAGTTT
TCTGGCAAGATTCCTGGTAGTTTGACCTCATGTTCGTCTCTTGCTATTTTTAATGTATCTTCCAATCAGTTTTCGGGTTC
TCTTCCATCTGGGATTTGGTCTTTGAATATTCTTAGATCTCTTGACTTGTCTAGTAATTTGTTAGAAGGAGAGATTCCTA
AAGGGATTGATAGTATGAATAATTTGCGCGTGATTAACTTGAGTAAGAACAGATTATCTGGGTCTGTTCCTGCTGGAATT
GGAAGCTGTTTGTTGTTAAAATATATTGATCTTAGCGATAATGCGCTATCTGGGTTCCTACCAGAGTCAATGCAGAAGCT
TAGTTCGTGTAATCATCTGAACTTGCGGAAGAACTCGCTTGAAGGTGAGGTCCCTAACTGGCTTGGAGAACTGAGGAACC
TGGAGAATTTGGATCTTTCTTCAAATAAGTTTTCCGGTCTGGTTCCCCATTCTATTGGTAACCTTCAGTCACTGAAGATG
ATGAATTTTTCTGCAAATGGTGTTACTGGAAACTTGCCTGAATCTTTGGTCAATTGCACCAACCTTTTGGCCTTAGATTT
TAGCCAAAATTCCATGACTGGTGATCTTCCGGGATGGCTTTTTCAATCGAATTTGCAACATGTTTCACTTTCCAGGACTA
ACACTGGAATAATGGATAGTCCCTTTTCTTCGTCAGTTGGGAATTCCATTCAGAAGCTTCAGGTCTTGGATTTATCACAC
AATTCATTATCTGGTGAGCTTAGAATTGGTATCAGAGTTTTGGGTGACTTGCAGGTCTTGAATCTGTCTAGGAACTCTCT
TGTTGGTAATATTCCAGCTTCTATTGGAGAGTTCAAGGACTTGACTGTTCTTGATTTGAGTTGCAATAAGCTCAACGGAA
GCATTCCTCTTGAAATTGGAGGATCTATTTCTTTGAAAGAATTGAGGCTGGAGGGCAACTTCCTAGATGGGAAAATTCCT
ACTTCAATTGGAAACTGTTCTTCACTTCAAGCTTTGATCCTGGCACAGAACAAGCTGGATGGCCCTGTACCTGTAGAGAT
GGCAAAACTAACAAACCTACAAGATGTAGACTTGTCATTTAACAACCTCACTGGAACGCTACCCAAGCAGTTAGCCAATC
TTGCACACCTCTACAACTTCAACATATCCCACAACCATTTGCAAGGTGAACTACCTGCTGGGTTTTTTAACACCATTTCA
CCCTATTCTGTCTCTGGTAATCCATCCCTATGTGGTTCGGCTGCCAATAAGTCTTGTCCAGCAGTTCTTCCTAAGCCCAT
CGTCCTCAATCCCAACTCAACTTCAGAAGCAAGTTCTGGGGTAATAGCTCCCAATTTGAGTCACAAAAGAATAATCCTCA
GCATATCTTCCCTCATTGCTATAGGTGCAGCTGCTGTCATTGTTATTGGGGTGATTGCAATCACTGTCCTCAATCTTCGT
GTTCGGGCATCAGCATCTCGATCCGCTGCAGCTCTTGCCTTATCTGCTGGGGATGACTTCAGCCGATCCCCAACTACAGA
TGCCAACTCTGGAAAACTTGTTATGTTTTCTGGTGAACCCGACTTCAGCACAGGAGCACATGCTTTGCTCAACAAGGATT
GTGAGCTTGGACGTGGTGGCTTCGGAGCAGTTTATCGGACGGTTCTTCGAGATGGGCAACCAGTTGCTATCAAGAAGCTC
ACAGTCTCAAGTCTTGTCAAGTCCCAAGAAGATTTTGAAAGGGAAGTGAAGAAACTAGGAAAAGTCAGGCACCCTAATCT
TGTGGCGCTCGAAGGATATTACTGGACTCCATCATTGCAGCTTCTAATTTCTGAGTTTGTTTCTGGTGGAAGTTTGTATA
AGCATCTACACGAAGGCTCAGGGGCAAACTTCCTTTCATGGAATGAAAGATTCAATATAATTCTTGGGACAGCAAGAAGC
CTAGCTCATTTGCACCAGTCAAACATCATTCACTACAACATAAAATCGAGCAACGTTTTGATTGACAGTTCAGGGGAGCC
AAAAGTGGGAGATTATGGCCTAGCAAGGTTGTTGCCAATGCTGGACAGATATGTTTTAAGCAGCAAGATCCAGAGTGCAC
TTGGCTACATGGCACCTGAGTTTGCCTGCAGAACAATAAAGATAACTGAGAAATGTGATGTTTACGGGTTTGGTGTGTTA
GTTCTTGAGGTTGTTACTGGAAAGAGGCCTGTTGAATACATGGAAGATGATGTCGTGGTGCTTTGTGACATGGTTAGAGG
AGCACTGGAAGAAGGTAAAGTGGAGGAATGTGTGGATGGTAGGCTACAGGGGAAGTTCCCAGTTGAGGAGGCAGTTCCAG
TGATGAAACTTGGTTTGATCTGCACTTCCCAAGTACCATCAAATCGGCCAGACATGGGAGAAGTAGTTAAAATATTGGAG
CTAATTAGATGCCCTTTAGACAGCCCAGAGGAGCTGGTATAA