Details for Papaya Locus evm.TU.supercontig_19.55

Position : sup19 ( 5`- 407791 .. 406879 -3` )
Annotation :
External links : CoGe
PGDD synteny : evm.TU.supercontig_19.55

Protein [Map View]
MEELHVLAVDDNLIDRKLVERLLMSSSCKGNFFLLYLFTIYIYVYAFIPNLVIYTEVVTYCSNYMYLCVTVLHAVTTAEN
ALRALEYLGLGEDEDNTSRPIVSNINLIITDYCMPGMTGFELLKKVKESSIMKEVPVVIMSSEDIPTRINKCLEEGAQMF
MLKPLKPSDVMKLKVNLLNCKA

DNA
ATGGAGGAGCTTCATGTTTTGGCAGTGGATGATAACCTCATTGACCGCAAACTGGTTGAGAGATTGCTCATGAGCTCCTC
TTGCAAAGGCAACTTCTTTCTCCTTTATCTCTTCACTATATATATATATGTATATGCATTTATTCCAAATCTTGTGATTT
ATACAGAGGTGGTGACATATTGCTCTAACTATATGTATCTGTGTGTGACTGTGCTGCATGCAGTGACTACTGCAGAGAAT
GCTCTGAGAGCTTTGGAGTATTTAGGCTTGGGGGAGGATGAAGACAACACTTCAAGGCCAATTGTCTCCAACATAAACTT
GATAATTACAGATTACTGTATGCCAGGAATGACAGGATTTGAGCTACTTAAGAAAGTCAAGGAATCATCGATCATGAAGG
AAGTTCCAGTTGTCATTATGTCATCTGAGGATATCCCAACACGCATTAACAAATGCTTGGAGGAAGGAGCCCAGATGTTC
ATGCTAAAGCCACTGAAACCTTCAGATGTCATGAAATTGAAGGTCAATCTGCTCAACTGCAAAGCCTGA