Details for Papaya Locus evm.TU.supercontig_19.47

Position : sup19 ( 5`- 374219 .. 375477 -3` )
Annotation :
External links : CoGe
PGDD synteny : evm.TU.supercontig_19.47

Protein [Map View]
MATLLEKPSAQKKRVIQELVKGQESANQLQLLLHKHLKEDGSVSVDELVEKILRSFTESLSVVRSCELGEKLQQADSFVH
DSPRTEDSGESRKSTAAKDRRGCYKRKKNTKAWTVVSPLVEDGHAWRKYGQKDILNAKFPRSYFRCTHKYDQGCKATKQV
QRLEHDPQQYQTTYIGDHTCIDTYKTPQIMSDSDSWVSYVVSNSSDSYTPSSSNQHPFSLSGLRQENKASDEQVIWKDLM
PLNSAEPAVYSCSEATSTSTHCLPMDFVVDFDTAFCFDHSGDFFNE

DNA
ATGGCTACTCTGCTTGAAAAACCATCTGCCCAGAAGAAAAGGGTAATACAAGAACTTGTCAAAGGCCAAGAATCTGCAAA
CCAGCTTCAGCTCTTGCTCCACAAGCACTTGAAAGAAGATGGATCTGTGTCAGTTGATGAATTGGTGGAGAAGATCTTGA
GATCTTTTACAGAGAGTCTTTCAGTTGTGAGGTCCTGTGAGTTGGGTGAGAAGCTTCAGCAGGCAGACTCTTTTGTTCAT
GATTCGCCGAGGACCGAGGATTCCGGTGAGAGCAGGAAGAGTACGGCTGCCAAGGACAGGAGAGGTTGCTACAAGAGAAA
GAAGAACACAAAGGCATGGACTGTAGTGTCTCCTCTCGTTGAAGATGGTCATGCTTGGAGAAAGTATGGACAAAAGGATA
TTCTCAATGCAAAATTTCCAAGGAGTTACTTCAGGTGCACCCACAAGTACGATCAGGGTTGTAAAGCAACCAAACAAGTC
CAAAGATTGGAGCACGATCCCCAACAATATCAAACCACTTATATAGGCGACCATACCTGTATTGACACTTACAAGACGCC
ACAAATTATGTCGGACTCAGACTCTTGGGTGTCTTATGTGGTTTCCAATTCCTCCGATTCATACACACCAAGTAGTAGTA
ATCAGCATCCTTTTAGCTTGTCAGGCTTGAGGCAAGAAAATAAAGCAAGCGATGAACAAGTGATTTGGAAGGATCTGATG
CCTCTAAACTCGGCTGAACCTGCTGTGTATTCATGTAGTGAAGCCACCTCTACTAGTACTCATTGTTTGCCCATGGACTT
TGTAGTGGATTTTGACACTGCTTTTTGTTTTGACCATTCTGGGGACTTCTTCAATGAGTAG