Details for Papaya Locus evm.TU.supercontig_19.41

Position : sup19 ( 5`- 335260 .. 337972 -3` )
Annotation :
External links : CoGe
PGDD synteny : evm.TU.supercontig_19.41

Protein [Map View]
MAGGLTPEVRLVRCPKCRNVLPELPDVPVYKCGGCETILIAKNRKFDTKSLSSLCKKDAAKTDDKSECKEPSPICNDSLL
PSSEECSLEQNNERGNIEFVDQNSKQLDAVNVVNEDEDNGSQQYKSENCNIEQYGVSSEACSSVDDVHENEEISPVASEN
SKVEANDAPVELARAESEIDVKGESQTNYVDPLATRGGDLSVPDHMPASESISRDIVESCFKRKSEEPLESDRHTFDRVM
STDTFATSDFYSPSSEFSGTLDYFSKSATIKSSCAYYDGSVSSYDRRDDQFSGQDIKFVEHNSKYTGLILPQVHNNMLDE
DKFLANSVMSSKSGMQKKAAVDKHYAIGGNKWDEDEFLEPSRLGHPVRNWTRLAREEYHSQRPLYPTGYESCSPSTQMGN
SSAHSLETAEQEQMKLLRMIYELQEQLHRTNLLSVKASAEVNWKQKSVPICYDGEALDQSYHDFNYARRSGTFGPESRYF
QQTKFFSGGATPSGNQTDNSCFCCHSRDWQCSRQLPVPALQYNRRFSRFHPAHIHYASDPSSPQRYKDSEFFMQHSEIQS
DDQRHRGEMKMHLRERHLVVKRHIRPTAGGAPFVTCYHCFKALQLPEDFLIFKKSCHRLRCGACSKVLKFSLENGTHIVQ
PTPGHVDPPPRHGKDNVDIKSRSFASTFNGYDDLGADSVSCSDNFGPYHNSQNNTAFRKMSYDSSEERRKVLLKQCSGKQ
KNSSKMLDLESVVYSSSMPKSENVSSGFRELHPARGSLLHQLMGYSSPSQVLRGSNSLASGTSLDHSEDLSLKN

DNA
ATGGCTGGCGGATTGACTCCTGAAGTTCGACTAGTTAGATGTCCTAAATGTCGAAACGTTCTTCCTGAACTCCCAGATGT
TCCCGTATATAAGTGTGGTGGATGTGAAACGATTTTGATAGCAAAGAACCGAAAGTTTGATACCAAAAGCTTGTCTAGCT
TATGTAAAAAAGATGCAGCTAAGACAGATGACAAATCAGAATGTAAAGAACCTAGTCCAATATGTAATGATTCACTTCTT
CCTTCCTCTGAAGAATGTTCATTGGAGCAAAATAATGAGAGGGGTAACATTGAATTTGTAGATCAGAATAGCAAACAGCT
TGATGCTGTGAATGTGGTAAATGAAGATGAAGACAATGGAAGTCAACAGTATAAATCCGAGAACTGCAATATTGAACAGT
ATGGGGTCTCCAGTGAAGCATGTTCATCAGTTGACGATGTTCATGAAAATGAAGAGATTTCACCAGTAGCATCAGAAAAT
TCAAAGGTGGAGGCAAATGATGCGCCGGTGGAATTAGCAAGAGCAGAATCAGAAATAGATGTAAAGGGTGAGAGTCAGAC
CAACTATGTGGATCCACTGGCTACAAGAGGAGGTGATTTGTCTGTTCCTGATCATATGCCGGCATCAGAAAGCATTTCAA
GAGATATTGTTGAATCTTGTTTTAAACGAAAATCAGAGGAACCTCTGGAAAGTGATCGCCATACTTTTGATCGTGTAATG
TCTACGGATACATTTGCAACTAGCGATTTTTACAGCCCAAGCTCTGAATTCAGTGGCACGCTTGATTATTTCTCCAAGTC
AGCAACCATCAAAAGCTCTTGTGCTTATTATGATGGCAGTGTTTCTTCTTATGACAGAAGGGATGATCAATTCTCTGGCC
AAGATATTAAGTTCGTTGAACATAATAGTAAATATACAGGACTAATTCTTCCTCAGGTCCATAATAATATGCTAGATGAG
GACAAATTTCTGGCGAATAGCGTGATGAGTAGCAAGTCTGGAATGCAAAAGAAGGCTGCTGTTGACAAGCATTATGCCAT
CGGAGGCAACAAATGGGATGAAGATGAATTTCTGGAACCCAGCAGACTTGGCCATCCAGTTAGAAACTGGACAAGACTAG
CCAGAGAGGAATATCATTCTCAACGGCCTTTATATCCGACTGGATATGAAAGCTGTAGTCCTTCCACTCAAATGGGCAAT
TCAAGCGCCCATTCACTTGAAACAGCAGAGCAGGAGCAGATGAAACTTCTAAGAATGATTTATGAGCTGCAGGAGCAACT
TCATAGAACAAATCTTCTGAGTGTTAAGGCTTCTGCTGAAGTTAATTGGAAACAAAAAAGTGTTCCTATATGCTATGATG
GTGAGGCATTGGACCAAAGTTATCATGACTTCAACTATGCTAGGCGTTCTGGAACTTTTGGGCCAGAAAGCAGGTATTTC
CAGCAGACCAAATTCTTTTCAGGAGGGGCAACACCCAGTGGAAACCAAACTGATAACTCATGCTTCTGTTGCCATTCCCG
AGATTGGCAATGTTCAAGGCAGTTGCCCGTTCCTGCTCTTCAATACAATAGACGATTTTCTAGGTTCCACCCTGCTCATA
TTCATTACGCCTCTGACCCATCAAGTCCACAAAGGTACAAGGATTCTGAGTTTTTTATGCAGCATAGTGAGATACAGTCT
GATGACCAGAGACATAGAGGTGAGATGAAGATGCATTTAAGGGAGAGACATCTTGTAGTTAAACGCCACATTCGTCCTAC
AGCTGGAGGAGCACCTTTTGTTACTTGTTATCATTGCTTCAAAGCACTACAGCTTCCTGAAGACTTCCTCATCTTCAAAA
AAAGTTGCCATCGGCTAAGATGTGGCGCTTGCTCTAAGGTACTTAAGTTCTCGCTTGAAAATGGAACTCATATAGTTCAA
CCCACACCAGGCCATGTAGACCCTCCTCCAAGGCATGGCAAGGACAATGTTGATATTAAAAGTAGGTCTTTCGCATCAAC
ATTCAATGGATATGATGATTTAGGTGCCGATTCTGTGTCCTGTTCTGACAATTTTGGACCATATCACAACTCCCAGAACA
ACACAGCTTTTAGGAAAATGTCCTATGATTCCTCAGAGGAGAGAAGAAAAGTATTGCTTAAGCAGTGTTCGGGAAAACAA
AAGAATTCAAGCAAAATGCTTGACCTTGAATCAGTTGTGTATTCCTCGAGTATGCCCAAATCAGAAAATGTATCCTCTGG
ATTTAGAGAGCTGCACCCAGCAAGAGGGTCACTGCTCCACCAACTCATGGGTTATTCTTCACCAAGCCAAGTGCTTAGAG
GGTCCAATTCACTTGCTTCAGGGACAAGCTTGGACCATTCAGAAGATCTGAGCTTGAAGAATTGA